|
SPAC1006.01 | SPAC1006.01.1 | 1 | 1 | 1 | 176 | 346 | forward | protein coding | No | 1878 | SPAC1006.01 | vacuolar serine protease Psp3 (predicted) | vacuolar serine protease Psp3 (predicted) | 2543256 | Q9UTS0 | I | Spom972h_chrI:5,067,494..5,069,371(+) | Spom972h_chrI:5067840..5069195(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 1003 | OG6_100121 | 1 | 451 | 1356 | 48732 | 5.51 | 0 | NN: MRVSWISGLLLVAHLAPSSAF, HMM: MRVSWISGLLLVAHLAPSSAF | NN Sum: 4, NN D: .77, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005615;GO:0000324;GO:0000328 | extracellular space;fungal-type vacuole;fungal-type vacuole lumen | GO:0008233;GO:0004252 | peptidase activity;serine-type endopeptidase activity | GO:0007039 | protein catabolic process in the vacuole | 3.4.21.- (Serine endopeptidases.) | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC1006.01ORvacuolar serine protease Psp3 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC1006.01 OR vacuolar serine protease Psp3 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC1071.04c | SPAC1071.04c.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 504 | SPAC1071.04c | signal peptidase subunit Spc2 (predicted) | signal peptidase subunit Spc2 (predicted) | 2541694 | Q9UTQ9 | I | Spom972h_chrI:3,863,001..3,863,504(-) | Spom972h_chrI:3863001..3863504(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 137 | OG6_103476 | 0 | 167 | 504 | 19051 | 9.44 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | GO:0008233 | peptidase activity | GO:0045047;GO:0006465 | protein targeting to ER;signal peptide processing | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC1071.04cORsignal peptidase subunit Spc2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC1071.04c OR signal peptidase subunit Spc2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC11D3.13 | SPAC11D3.13.1 | 1 | 1 | 1 | 271 | 181 | forward | protein coding | No | 1121 | SPAC11D3.13 | ThiJ domain protein | ThiJ domain protein | 2542927 | Q10092 | I | Spom972h_chrI:130,148..131,268(+) | Spom972h_chrI:130329..130997(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 0 | OG6_186136 | 0 | 222 | 669 | 24225 | 8.83 | 0 | | | | | | | | | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0003824;GO:0019172 | catalytic activity;glyoxalase III activity | | | 4.2.1.130 (D-lactate dehydratase) | 4.2.1.130 (D-lactate dehydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC11D3.13ORThiJ domain proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC11D3.13 OR ThiJ domain protein AND Schizosaccharomyces pombe 972h- |
|
SPAC1296.03c | SPAC1296.03c.1 | 1 | 1 | 1 | 274 | 56 | reverse | protein coding | No | 1854 | SPAC1296.03c | serine carboxypeptidase Sxa2 | serine carboxypeptidase Sxa2 | 2541701 | P32825 | I | Spom972h_chrI:712,217..714,070(-) | Spom972h_chrI:712491..714014(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 231 | OG6_114255 | 0 | 507 | 1524 | 56614 | 4.52 | 0 | NN: MLSLFLKSLFAIIIIELTIIHAL, HMM: MLSLFLKSLFAIIIIELTIIHAL | NN Sum: 4, NN D: .81, HMM Prob: .98 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | GO:0005829;GO:0005576;GO:0005634 | cytosol;extracellular region;nucleus | GO:0004180;GO:0004185 | carboxypeptidase activity;serine-type carboxypeptidase activity | GO:0000747;GO:0031138;GO:0010515;GO:0090029;GO:0051603 | conjugation with cellular fusion;negative regulation of conjugation with cellular fusion;negative regulation of induction of conjugation with cellular fusion;negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion;proteolysis involved in cellular p | 3.4.16.- (Serine-type carboxypeptidases.) | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC1296.03cORserine carboxypeptidase Sxa2ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC1296.03c OR serine carboxypeptidase Sxa2 AND Schizosaccharomyces pombe 972h- |
|
SPAC12B10.05 | SPAC12B10.05.1 | 12 | 12 | 1 | 178 | 79 | forward | protein coding | No | 1718 | SPAC12B10.05 | mitochondrial intermediate cleavage peptidase Icp55 (predicted) | mitochondrial intermediate cleavage peptidase Icp55 (predicted) | 2542952 | Q10439 | I | Spom972h_chrI:4,582,299..4,584,511(+) | Spom972h_chrI:4582378..4584333(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 242 | OG6_100598 | 1 | 486 | 1461 | 55140 | 7.69 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | GO:0005739 | mitochondrion | GO:0070006 | metalloaminopeptidase activity | GO:0034982;GO:0007005 | mitochondrial protein processing;mitochondrion organization | 3.4.11.26 (Intermediate cleaving peptidase 55) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC12B10.05ORmitochondrial intermediate cleavage peptidase Icp55 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC12B10.05 OR mitochondrial intermediate cleavage peptidase Icp55 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC12B10.12c | SPAC12B10.12c.1 | 1 | 1 | 1 | 273 | 331 | reverse | protein coding | No | 2521 | SPAC12B10.12c | DNA repair protein Rhp41 | DNA repair protein Rhp41 | 2542967 | Q10445 | I | Spom972h_chrI:4,593,600..4,596,120(-) | Spom972h_chrI:4593873..4595789(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 236 | OG6_102113 | 1 | 638 | 1917 | 73518 | 9.56 | 0 | | | | | GO:0003677;GO:0003684 | DNA binding;damaged DNA binding | | | GO:0071942;GO:0005737;GO:0072686;GO:0000109;GO:0000111;GO:0005634 | XPC complex;cytoplasm;mitotic spindle;nucleotide-excision repair complex;nucleotide-excision repair factor 2 complex;nucleus | GO:0003684;GO:0003697 | damaged DNA binding;single-stranded DNA binding | GO:0006298;GO:0006289 | mismatch repair;nucleotide-excision repair | | 2.1.1.201 (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC12B10.12cORDNA repair protein Rhp41ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC12B10.12c OR DNA repair protein Rhp41 AND Schizosaccharomyces pombe 972h- |
|
SPAC12G12.11c | SPAC12G12.11c.1 | 3 | 3 | 1 | 140 | 254 | forward | protein coding | No | 1492 | SPAC12G12.11c | DUF544 family protein | DUF544 family protein | 2543045 | Q09874 | I | Spom972h_chrI:326,440..328,122(+) | Spom972h_chrI:326694..327982(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 152 | OG6_102202 | 0 | 365 | 1098 | 42280 | 5.37 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | GO:0005829;GO:0005634 | cytosol;nucleus | GO:1990380;GO:0016807;GO:0005515 | Lys48-specific deubiquitinase activity;cysteine-type carboxypeptidase activity;protein binding | GO:0071108 | protein K48-linked deubiquitination | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC12G12.11cORDUF544 family proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC12G12.11c OR DUF544 family protein AND Schizosaccharomyces pombe 972h- |
|
SPAC13A11.04c | SPAC13A11.04c.1 | 6 | 6 | 1 | 367 | 163 | reverse | protein coding | No | 1880 | SPAC13A11.04c | SAGA complex ubiquitin C-terminal hydrolase Ubp8 | SAGA complex ubiquitin C-terminal hydrolase Ubp8 | 2542135 | Q09738 | I | Spom972h_chrI:579,353..581,553(-) | Spom972h_chrI:579720..581390(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 153 | OG6_102914 | 0 | 449 | 1350 | 51720 | 7.83 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0000124;GO:0005730;GO:0005654;GO:0005634 | SAGA complex;nucleolus;nucleoplasm;nucleus | GO:0004197;GO:0004843 | cysteine-type endopeptidase activity;thiol-dependent ubiquitin-specific protease activity | GO:0006338;GO:0035616;GO:0016573;GO:0016579;GO:0006357 | chromatin remodeling;histone H2B conserved C-terminal lysine deubiquitination;histone acetylation;protein deubiquitination;regulation of transcription by RNA polymerase II | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC13A11.04cORSAGA complex ubiquitin C-terminal hydrolase Ubp8ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC13A11.04c OR SAGA complex ubiquitin C-terminal hydrolase Ubp8 AND Schizosaccharomyces pombe 972h- |
|
SPAC13A11.05 | SPAC13A11.05.1 | 1 | 1 | 1 | 369 | 219 | forward | protein coding | No | 2130 | SPAC13A11.05 | peptidase family M17 cytoplasmic leucyl aminopeptidase yspII (LAP yspII) | peptidase family M17 cytoplasmic leucyl aminopeptidase yspII (LAP yspII) | 2542130 | Q09735 | I | Spom972h_chrI:582,273..584,402(+) | Spom972h_chrI:582492..584033(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 51 | OG6_100682 | 0 | 513 | 1542 | 56194 | 6.14 | 0 | HMM: MKGLGLSTRTFNWSSLSSILLPRIPLATTK, NN: MKGLGLSTRTFNWSSLSSILLPRIPLATTKAD | NN Sum: 2, NN D: .41, HMM Prob: .52 | GO:0005737;GO:0005622 | cytoplasm;intracellular | GO:0004177;GO:0030145;GO:0008235 | aminopeptidase activity;manganese ion binding;metalloexopeptidase activity | GO:0006508 | proteolysis | | | GO:0004177 | aminopeptidase activity | GO:0030163 | protein catabolic process | 3.4.11.- (Aminopeptidases.) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC13A11.05ORpeptidase family M17 cytoplasmic leucyl aminopeptidase yspII (LAP yspII)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC13A11.05 OR peptidase family M17 cytoplasmic leucyl aminopeptidase yspII (LAP yspII) AND Schizosaccharomyces pombe 972h- |
|
SPAC13C5.01c | SPAC13C5.01c.1 | 1 | 1 | 1 | 551 | 33 | reverse | protein coding | No | 1331 | SPAC13C5.01c | 20S proteasome complex subunit alpha 3 Pre9 (predicted) | 20S proteasome complex subunit alpha 3 Pre9 (predicted) | 3361518 | Q09682 | I | Spom972h_chrI:423,926..425,256(-) | Spom972h_chrI:424477..425223(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 154 | OG6_101968 | 0 | 248 | 747 | 27925 | 6.14 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829;GO:0005634;GO:0005839;GO:0019773 | cytoplasm;cytosol;nucleus;proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC13C5.01cOR20S proteasome complex subunit alpha 3 Pre9 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC13C5.01c OR 20S proteasome complex subunit alpha 3 Pre9 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC14C4.15c | SPAC14C4.15c.1 | 2 | 2 | 1 | 36 | 98 | reverse | protein coding | No | 2696 | SPAC14C4.15c | dipeptidyl peptidase (predicted) | dipeptidyl peptidase (predicted) | 2542105 | Q9P7E9 | I | Spom972h_chrI:5,259,112..5,261,851(-) | Spom972h_chrI:5259148..5261753(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 2 | OG6_137980 | 0 | 853 | 2562 | 98341 | 6.45 | 1 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0000329;GO:0016021 | fungal-type vacuole membrane;integral component of membrane | GO:0008239 | dipeptidyl-peptidase activity | GO:0016485 | protein processing | 3.4.14.- (Dipeptidyl-peptidases and tripeptidyl-peptidases.) | 3.4.14.- (Dipeptidyl-peptidases and tripeptidyl-peptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC14C4.15cORdipeptidyl peptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC14C4.15c OR dipeptidyl peptidase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC1687.02 | SPAC1687.02.1 | 2 | 2 | 1 | 1215 | 240 | forward | protein coding | No | 2271 | SPAC1687.02 | CAAX prenyl protease (predicted) | CAAX prenyl protease (predicted) | 2542754 | O94448 | I | Spom972h_chrI:904,026..906,347(+) | Spom972h_chrI:904266..905132(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 156 | OG6_103186 | 0 | 271 | 816 | 31024 | 8.70 | 5 | HMM: MRVYLISFFFTAIYVVSLYTF, NN: MRVYLISFFFTAIYVVSLYTFPVARPR | NN Sum: 4, NN D: .68, HMM Prob: .75 | GO:0016020 | membrane | | | | | GO:0005783;GO:0030176 | endoplasmic reticulum;integral component of endoplasmic reticulum membrane | GO:0004197;GO:0004222 | cysteine-type endopeptidase activity;metalloendopeptidase activity | GO:0071586;GO:0007323 | CAAX-box protein processing;peptide pheromone maturation | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC1687.02ORCAAX prenyl protease (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC1687.02 OR CAAX prenyl protease (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC1687.17c | SPAC1687.17c.1 | 4 | 4 | 1 | 308 | 92 | reverse | protein coding | No | 973 | SPAC1687.17c | Der1-like (degradation in the ER) family (predicted) | Der1-like (degradation in the ER) family (predicted) | 2542379 | O94458 | I | Spom972h_chrI:934,941..936,081(-) | Spom972h_chrI:935249..935989(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 156 | OG6_101672 | 0 | 190 | 573 | 22235 | 9.73 | 5 | | | GO:0016021 | integral component of membrane | | | | | GO:0005783;GO:0005789 | endoplasmic reticulum;endoplasmic reticulum membrane | GO:0003674 | molecular_function | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC1687.17cORDer1-like (degradation in the ER) family (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC1687.17c OR Der1-like (degradation in the ER) family (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC17A5.04c | SPAC17A5.04c.1 | 2 | 2 | 1 | 143 | | reverse | protein coding | No | 1682 | SPAC17A5.04c | spore wall assembly ADAM family peptidase Mde10 | spore wall assembly ADAM family peptidase Mde10 | 2542178 | O13766 | I | Spom972h_chrI:1,757,450..1,759,202(-) | Spom972h_chrI:1757593..1759202(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 155 | OG6_111437 | 0 | 512 | 1539 | 56439 | 5.30 | 0 | NN: MRLVLLFSCVLAVSSYAE, HMM: MRLVLLFSCVLAVSSYAE | NN Sum: 4, NN D: .81, HMM Prob: 1 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005619;GO:0005783;GO:0005789 | ascospore wall;endoplasmic reticulum;endoplasmic reticulum membrane | GO:0008270 | zinc ion binding | GO:0030476 | ascospore wall assembly | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC17A5.04cORspore wall assembly ADAM family peptidase Mde10ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC17A5.04c OR spore wall assembly ADAM family peptidase Mde10 AND Schizosaccharomyces pombe 972h- |
|
SPAC17A5.07c | SPAC17A5.07c.1 | 7 | 7 | 1 | 103 | 47 | reverse | protein coding | No | 2067 | SPAC17A5.07c | SUMO deconjugating cysteine peptidase Ulp2 (predicted) | SUMO deconjugating cysteine peptidase Ulp2 (predicted) | 2542268 | O13769 | I | Spom972h_chrI:1,764,233..1,766,758(-) | Spom972h_chrI:1764336..1766711(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 191 | OG6_102905 | 0 | 638 | 1917 | 71916 | 8.72 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0010494;GO:0005634 | cytoplasmic stress granule;nucleus | GO:0070140;GO:0005515 | SUMO-specific isopeptidase activity;protein binding | GO:0016926;GO:0070647;GO:2000765 | protein desumoylation;protein modification by small protein conjugation or removal;regulation of cytoplasmic translation | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC17A5.07cORSUMO deconjugating cysteine peptidase Ulp2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC17A5.07c OR SUMO deconjugating cysteine peptidase Ulp2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC1952.03 | SPAC1952.03.1 | 2 | 2 | 1 | 169 | 296 | forward | protein coding | No | 1440 | SPAC1952.03 | ubiquitin specific cysteine protease, OTU family, Otu2 | ubiquitin specific cysteine protease, OTU family, Otu2 | 2542554 | Q9UUK3 | I | Spom972h_chrI:4,970,821..4,972,306(+) | Spom972h_chrI:4971117..4972137(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 156 | OG6_102788 | 0 | 324 | 975 | 37516 | 8.34 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | | | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0070647;GO:0030433 | protein deubiquitination;protein modification by small protein conjugation or removal;ubiquitin-dependent ERAD pathway | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC1952.03ORubiquitin specific cysteine protease, OTU family, Otu2ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC1952.03 OR ubiquitin specific cysteine protease, OTU family, Otu2 AND Schizosaccharomyces pombe 972h- |
|
SPAC19A8.08 | SPAC19A8.08.1 | 1 | 1 | 1 | 218 | 118 | reverse | protein coding | No | 3486 | SPAC19A8.08 | nonsense-mediated decay protein Upf2 | nonsense-mediated decay protein Upf2 | 2542147 | O13824 | I | Spom972h_chrI:2,468,576..2,472,061(-) | Spom972h_chrI:2468794..2471943(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 205 | OG6_103377 | 0 | 1049 | 3150 | 122094 | 5.22 | 0 | | | | | GO:0003723;GO:0005488;GO:0005515 | RNA binding;binding;protein binding | | | GO:0005737;GO:0005829;GO:0035145;GO:0005844 | cytoplasm;cytosol;exon-exon junction complex;polysome | | | GO:0070478;GO:0000184 | nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay;nuclear-transcribed mRNA catabolic process, nonsense-mediated decay | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC19A8.08ORnonsense-mediated decay protein Upf2ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC19A8.08 OR nonsense-mediated decay protein Upf2 AND Schizosaccharomyces pombe 972h- |
|
SPAC19B12.06c | SPAC19B12.06c.1 | 4 | 4 | 1 | 125 | 305 | reverse | protein coding | No | 1207 | SPAC19B12.06c | rhomboid family protease associated with COP1 coated vesicle (predicted) | rhomboid family protease associated with COP1 coated vesicle (predicted) | 2542407 | Q9P375 | I | Spom972h_chrI:4,893,974..4,895,378(-) | Spom972h_chrI:4894099..4895073(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 2 | OG6_473970 | 0 | 258 | 777 | 28592 | 5.50 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0030137;GO:0005794 | COPI-coated vesicle;Golgi apparatus | GO:0004252 | serine-type endopeptidase activity | GO:0008150 | biological_process | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC19B12.06cORrhomboid family protease associated with COP1 coated vesicle (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC19B12.06c OR rhomboid family protease associated with COP1 coated vesicle (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC19B12.08 | SPAC19B12.08.1 | 2 | 2 | 1 | 726 | 205 | forward | protein coding | No | 1894 | SPAC19B12.08 | Atg8 deconjugator Atg4 (predicted) | Atg8 deconjugator Atg4 (predicted) | 2542182 | Q9P373 | I | Spom972h_chrI:4,897,936..4,900,012(+) | Spom972h_chrI:4898141..4899286(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 155 | OG6_100501 | 0 | 320 | 963 | 36928 | 4.70 | 0 | | | | | | | | | GO:0005829;GO:0005634 | cytosol;nucleus | GO:0019786 | Atg8-specific protease activity | GO:0000045;GO:0006914;GO:0016236;GO:0070647 | autophagosome assembly;autophagy;macroautophagy;protein modification by small protein conjugation or removal | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC19B12.08ORAtg8 deconjugator Atg4 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC19B12.08 OR Atg8 deconjugator Atg4 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC19G12.10c | SPAC19G12.10c.1 | 1 | 1 | 1 | 133 | 434 | reverse | protein coding | No | 3576 | SPAC19G12.10c | vacuolar carboxypeptidase Y | vacuolar carboxypeptidase Y | 2542465 | O13849 | I | Spom972h_chrI:4,061,377..4,064,952(-) | Spom972h_chrI:4061510..4064518(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 818 | OG6_100109 | 1 | 1002 | 3009 | 114236 | 5.25 | 0 | NN: MLMKQTFLYFLLTCVVSAQ, HMM: MLMKQTFLYFLLTCVVSAQ | NN Sum: 4, NN D: .88, HMM Prob: .99 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | GO:0000324 | fungal-type vacuole | GO:0004185 | serine-type carboxypeptidase activity | GO:0008150;GO:0046938;GO:0051603 | biological_process;phytochelatin biosynthetic process;proteolysis involved in cellular protein catabolic process | 3.4.16.5 (Carboxypeptidase C) | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC19G12.10cORvacuolar carboxypeptidase YANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC19G12.10c OR vacuolar carboxypeptidase Y AND Schizosaccharomyces pombe 972h- |
|
SPAC1F3.10c | SPAC1F3.10c.1 | 1 | 1 | 1 | 2125 | 119 | reverse | protein coding | No | 4533 | SPAC1F3.10c | mitochondrial intermediate peptidase Oct1 (predicted) | mitochondrial intermediate peptidase Oct1 (predicted) | 2541640 | Q10415 | I | Spom972h_chrI:634,898..639,430(-) | Spom972h_chrI:637023..639311(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 161 | OG6_102110 | 0 | 762 | 2289 | 86284 | 8.13 | 0 | | | | | GO:0046872;GO:0004222 | metal ion binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005759;GO:0005739 | mitochondrial matrix;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0006879;GO:0006518;GO:0006627;GO:0006508 | cellular iron ion homeostasis;peptide metabolic process;protein processing involved in protein targeting to mitochondrion;proteolysis | 3.4.24.59 (Mitochondrial intermediate peptidase) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC1F3.10cORmitochondrial intermediate peptidase Oct1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC1F3.10c OR mitochondrial intermediate peptidase Oct1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC1F7.06 | SPAC1F7.06.1 | 1 | 1 | 1 | 952 | 235 | forward | protein coding | No | 1943 | SPAC1F7.06 | ThiJ domain protein | ThiJ domain protein | 2541687 | Q09918 | I | Spom972h_chrI:4,230,615..4,232,557(+) | Spom972h_chrI:4230850..4231605(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 278 | OG6_105123 | 3 | 251 | 756 | 27906 | 4.21 | 0 | | | | | | | | | GO:0005829;GO:0005634 | cytosol;nucleus | GO:0003824;GO:0036524 | catalytic activity;protein deglycase activity | GO:0008150;GO:0106046;GO:0036529 | biological_process;guanine deglycation, glyoxal removal;protein deglycation, glyoxal removal | 4.2.1.130 (D-lactate dehydratase) | 4.2.1.130 (D-lactate dehydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC1F7.06ORThiJ domain proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC1F7.06 OR ThiJ domain protein AND Schizosaccharomyces pombe 972h- |
|
SPAC222.08c | SPAC222.08c.1 | 1 | 1 | 1 | 279 | 424 | reverse | protein coding | No | 1408 | SPAC222.08c | glutamine aminotransferase subunit Sno1 (predicted) | glutamine aminotransferase subunit Sno1 (predicted) | 2541464 | Q9UTE4 | I | Spom972h_chrI:957,367..958,774(-) | Spom972h_chrI:957646..958350(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 160 | OG6_103407 | 0 | 234 | 705 | 25901 | 5.13 | 0 | | | | | GO:0004359 | glutaminase activity | GO:0042823;GO:0042819 | pyridoxal phosphate biosynthetic process;vitamin B6 biosynthetic process | GO:0005737;GO:0005829;GO:1903600 | cytoplasm;cytosol;glutaminase complex | GO:0004359 | glutaminase activity | GO:0042823;GO:0008615;GO:0008614;GO:0042819 | pyridoxal phosphate biosynthetic process;pyridoxine biosynthetic process;pyridoxine metabolic process;vitamin B6 biosynthetic process | 3.5.1.2 (Glutaminase) | 3.5.1.2 (Glutaminase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC222.08cORglutamine aminotransferase subunit Sno1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC222.08c OR glutamine aminotransferase subunit Sno1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC22E12.03c | SPAC22E12.03c.1 | 2 | 2 | 1 | 293 | 154 | reverse | protein coding | No | 1023 | SPAC22E12.03c | glyoxylase III sdj1 | glyoxylase III sdj1 | 2541772 | Q10356 | I | Spom972h_chrI:5,022,786..5,023,906(-) | Spom972h_chrI:5023079..5023752(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 63 | OG6_101257 | 0 | 191 | 576 | 21078 | 8.15 | 0 | | | | | | | | | GO:0005737;GO:0005829;GO:0005634 | cytoplasm;cytosol;nucleus | GO:0019172;GO:0005515;GO:0036524 | glyoxalase III activity;protein binding;protein deglycase activity | GO:1990748;GO:0106046;GO:0036525;GO:0036529 | cellular detoxification;guanine deglycation, glyoxal removal;protein deglycation;protein deglycation, glyoxal removal | 4.2.1.130 (D-lactate dehydratase) | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC22E12.03cORglyoxylase III sdj1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC22E12.03c OR glyoxylase III sdj1 AND Schizosaccharomyces pombe 972h- |
|
SPAC22E12.09c | SPAC22E12.09c.1 | 1 | 1 | 1 | 253 | 52 | reverse | protein coding | No | 2435 | SPAC22E12.09c | kexin | kexin | 2542576 | Q09175 | I | Spom972h_chrI:5,034,187..5,036,621(-) | Spom972h_chrI:5034440..5036569(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 152 | OG6_100362 | 0 | 709 | 2130 | 78125 | 4.93 | 1 | HMM: MHPALLCGPILAIFLQFLVSSCS, NN: MHPALLCGPILAIFLQFLVSSCS | NN Sum: 4, NN D: .7, HMM Prob: 1 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005794;GO:0009986;GO:0030173;GO:0016020;GO:0005802 | Golgi apparatus;cell surface;integral component of Golgi membrane;membrane;trans-Golgi network | GO:0004175;GO:0070011;GO:0004252;GO:0004867 | endopeptidase activity;peptidase activity, acting on L-amino acid peptides;serine-type endopeptidase activity;serine-type endopeptidase inhibitor activity | GO:0071432;GO:0016540;GO:0016485;GO:0006508 | peptide mating pheromone maturation involved in positive regulation of conjugation with cellular fusion;protein autoprocessing;protein processing;proteolysis | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC22E12.09cORkexinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC22E12.09c OR kexin AND Schizosaccharomyces pombe 972h- |
|
SPAC22F3.06c | SPAC22F3.06c.1 | 1 | 1 | 1 | 96 | 317 | forward | protein coding | No | 3617 | SPAC22F3.06c | Lon protease homolog Lon1 (predicted) | Lon protease homolog Lon1 (predicted) | 2541875 | Q09769 | I | Spom972h_chrI:693,514..697,130(+) | Spom972h_chrI:693831..697034(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 343 | OG6_100411 | 0 | 1067 | 3204 | 118640 | 7.22 | 0 | | | | | GO:0005524;GO:0004176;GO:0043565;GO:0004252 | ATP binding;ATP-dependent peptidase activity;sequence-specific DNA binding;serine-type endopeptidase activity | GO:0034599;GO:0051131;GO:0070407;GO:0006515;GO:0006508 | cellular response to oxidative stress;chaperone-mediated protein complex assembly;oxidation-dependent protein catabolic process;protein quality control for misfolded or incompletely synthesized proteins;proteolysis | GO:0005759;GO:0005739 | mitochondrial matrix;mitochondrion | GO:0005524;GO:0004176;GO:0004252;GO:0003697 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity;single-stranded DNA binding | GO:0051131;GO:0035694;GO:0007005;GO:0006515 | chaperone-mediated protein complex assembly;mitochondrial protein catabolic process;mitochondrion organization;protein quality control for misfolded or incompletely synthesized proteins | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC22F3.06cORLon protease homolog Lon1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC22F3.06c OR Lon protease homolog Lon1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC22F8.06 | SPAC22F8.06.1 | 1 | 1 | 1 | 192 | 203 | forward | protein coding | No | 1073 | SPAC22F8.06 | 20S proteasome complex subunit beta 6 | 20S proteasome complex subunit beta 6 | 2542062 | Q9UQY2 | I | Spom972h_chrI:4,795,276..4,796,348(+) | Spom972h_chrI:4795479..4796156(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 154 | OG6_101631 | 0 | 225 | 678 | 25082 | 7.59 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005829;GO:0005634;GO:0005839;GO:0019774 | cytoplasm;cytosol;nucleus;proteasome core complex;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC22F8.06OR20S proteasome complex subunit beta 6ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC22F8.06 OR 20S proteasome complex subunit beta 6 AND Schizosaccharomyces pombe 972h- |
|
SPAC22G7.01c | SPAC22G7.01c.1 | 3 | 3 | 1 | 216 | 166 | reverse | protein coding | No | 2179 | SPAC22G7.01c | iron responsive transcriptional regulator, peptidase family (predicted) | iron responsive transcriptional regulator, peptidase family (predicted) | 2541673 | Q09795 | I | Spom972h_chrI:725,865..728,242(-) | Spom972h_chrI:726081..728076(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 219 | OG6_100896 | 0 | 598 | 1797 | 66680 | 5.87 | 0 | | | | | GO:0016787;GO:0046872;GO:0070006 | hydrolase activity;metal ion binding;metalloaminopeptidase activity | | | GO:0005737;GO:0005829;GO:0005634 | cytoplasm;cytosol;nucleus | GO:0070006 | metalloaminopeptidase activity | GO:0034396 | negative regulation of transcription from RNA polymerase II promoter in response to iron | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC22G7.01cORiron responsive transcriptional regulator, peptidase family (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC22G7.01c OR iron responsive transcriptional regulator, peptidase family (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC22G7.04 | SPAC22G7.04.1 | 7 | 7 | 1 | 138 | 54 | forward | protein coding | No | 3459 | SPAC22G7.04 | ubiquitin C-terminal hydrolase, poly(A)-specific ribonuclease complex subunit Pan2 (predicted) | ubiquitin C-terminal hydrolase, poly(A)-specific ribonuclease complex subunit Pan2 (predicted) | 2541684 | Q09798 | I | Spom972h_chrI:732,826..736,603(+) | Spom972h_chrI:732880..736465(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 155 | OG6_102772 | 0 | 1088 | 3267 | 123872 | 5.79 | 0 | | | | | GO:0046872;GO:0004535;GO:0005515 | metal ion binding;poly(A)-specific ribonuclease activity;protein binding | | | GO:0000932;GO:0031251;GO:0005737 | P-body;PAN complex;cytoplasm | GO:0004535;GO:0004843 | poly(A)-specific ribonuclease activity;thiol-dependent ubiquitin-specific protease activity | GO:0000289;GO:0070647 | nuclear-transcribed mRNA poly(A) tail shortening;protein modification by small protein conjugation or removal | 3.1.13.4 (Poly(A)-specific ribonuclease) | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC22G7.04ORubiquitin C-terminal hydrolase, poly(A)-specific ribonuclease complex subunit Pan2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC22G7.04 OR ubiquitin C-terminal hydrolase, poly(A)-specific ribonuclease complex subunit Pan2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC22H12.03 | SPAC22H12.03.1 | 3 | 3 | 1 | 86 | 209 | forward | protein coding | No | 1108 | SPAC22H12.03 | mitochondrial hydrolase (predicted) | mitochondrial hydrolase (predicted) | 2541745 | O94437 | I | Spom972h_chrI:896,668..897,900(+) | Spom972h_chrI:896877..897767(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 180 | OG6_101420 | 0 | 270 | 813 | 30749 | 9.65 | 0 | | | | | | | | | GO:0005739 | mitochondrion | GO:0008474 | palmitoyl-(protein) hydrolase activity | GO:0006631 | fatty acid metabolic process | 3.1.-.- (Acting on ester bonds.) | | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC22H12.03ORmitochondrial hydrolase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC22H12.03 OR mitochondrial hydrolase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC23D3.07 | SPAC23D3.07.1 | 3 | 3 | 1 | 435 | 215 | forward | protein coding | No | 1454 | SPAC23D3.07 | 20S proteasome complex subunit beta 2 (predicted) | 20S proteasome complex subunit beta 2 (predicted) | 2541805 | Q09841 | I | Spom972h_chrI:4,350,803..4,352,369(+) | Spom972h_chrI:4351018..4351934(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 154 | OG6_101382 | 0 | 267 | 804 | 29337 | 6.63 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005829;GO:0005635;GO:0005634;GO:0005839;GO:0019774 | cytoplasm;cytosol;nuclear envelope;nucleus;proteasome core complex;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC23D3.07OR20S proteasome complex subunit beta 2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC23D3.07 OR 20S proteasome complex subunit beta 2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC23G3.08c | SPAC23G3.08c.1 | 1 | 1 | 1 | 363 | 581 | reverse | protein coding | No | 3572 | SPAC23G3.08c | ubiquitin C-terminal hydrolase Ubp7 | ubiquitin C-terminal hydrolase Ubp7 | 2541845 | Q9P7S5 | I | Spom972h_chrI:880,660..884,231(-) | Spom972h_chrI:881023..883650(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 10 | OG6_103128 | 0 | 875 | 2628 | 98376 | 7.30 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0004197;GO:0004843 | cysteine-type endopeptidase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC23G3.08cORubiquitin C-terminal hydrolase Ubp7ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC23G3.08c OR ubiquitin C-terminal hydrolase Ubp7 AND Schizosaccharomyces pombe 972h- |
|
SPAC23G3.12c | SPAC23G3.12c.1 | 1 | 1 | 1 | 72 | 91 | reverse | protein coding | No | 3154 | SPAC23G3.12c | serine protease (predicted) | serine protease (predicted) | 2541812 | Q9P7S1 | I | Spom972h_chrI:889,058..892,211(-) | Spom972h_chrI:889130..892120(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 237 | OG6_107381 | 1 | 996 | 2991 | 110406 | 5.85 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005634 | nucleus | GO:0004252 | serine-type endopeptidase activity | GO:0044255 | cellular lipid metabolic process | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC23G3.12cORserine protease (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC23G3.12c OR serine protease (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC23H4.09 | SPAC23H4.09.1 | 1 | 1 | 1 | 65 | 111 | reverse | protein coding | No | 1322 | SPAC23H4.09 | curved DNA-binding protein Cdb4, peptidase family | curved DNA-binding protein Cdb4, peptidase family | 2541817 | Q09184 | I | Spom972h_chrI:1,591,873..1,593,194(-) | Spom972h_chrI:1591938..1593083(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 161 | OG6_101895 | 0 | 381 | 1146 | 41597 | 8.26 | 0 | | | | | | | | | GO:0005737;GO:0005829;GO:0005730;GO:0005634 | cytoplasm;cytosol;nucleolus;nucleus | GO:0003677;GO:0004518;GO:0003676 | DNA binding;nuclease activity;nucleic acid binding | GO:0008150 | biological_process | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC23H4.09ORcurved DNA-binding protein Cdb4, peptidase familyANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC23H4.09 OR curved DNA-binding protein Cdb4, peptidase family AND Schizosaccharomyces pombe 972h- |
|
SPAC24C9.08 | SPAC24C9.08.1 | 2 | 2 | 1 | 125 | 342 | forward | protein coding | No | 2258 | SPAC24C9.08 | vacuolar carboxypeptidase (predicted) | vacuolar carboxypeptidase (predicted) | 2541555 | O13968 | I | Spom972h_chrI:3,061,210..3,063,526(+) | Spom972h_chrI:3061611..3063401(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 190 | OG6_104171 | 0 | 596 | 1791 | 66606 | 4.62 | 1 | | | GO:0016021 | integral component of membrane | GO:0016787;GO:0046872;GO:0004181 | hydrolase activity;metal ion binding;metallocarboxypeptidase activity | GO:0008152 | metabolic process | GO:0000324;GO:0000328 | fungal-type vacuole;fungal-type vacuole lumen | GO:0004180 | carboxypeptidase activity | GO:0006807;GO:0007039;GO:0051603 | nitrogen compound metabolic process;protein catabolic process in the vacuole;proteolysis involved in cellular protein catabolic process | 3.4.17.- (Metallocarboxypeptidases.) | 3.4.17.4 (Gly-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC24C9.08ORvacuolar carboxypeptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC24C9.08 OR vacuolar carboxypeptidase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC24C9.14 | SPAC24C9.14.1 | 1 | 1 | 1 | 3056 | 331 | forward | protein coding | No | 4377 | SPAC24C9.14 | ubiquitin-specific cysteine protease, OTU family, Otu1 | ubiquitin-specific cysteine protease, OTU family, Otu1 | 2542649 | O13974 | I | Spom972h_chrI:3,072,847..3,077,223(+) | Spom972h_chrI:3073178..3074167(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 158 | OG6_102949 | 0 | 329 | 990 | 35667 | 5.11 | 0 | | | | | GO:0046872;GO:0004843;GO:1904265 | metal ion binding;thiol-dependent ubiquitin-specific protease activity;ubiquitin-specific protease activity involved in negative regulation of retrograde protein transport, ER to cytosol | GO:0016579 | protein deubiquitination | GO:0005737;GO:0005829;GO:0005634 | cytoplasm;cytosol;nucleus | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0030968;GO:0016579;GO:0030433 | endoplasmic reticulum unfolded protein response;protein deubiquitination;ubiquitin-dependent ERAD pathway | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC24C9.14ORubiquitin-specific cysteine protease, OTU family, Otu1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC24C9.14 OR ubiquitin-specific cysteine protease, OTU family, Otu1 AND Schizosaccharomyces pombe 972h- |
|
SPAC25B8.17 | SPAC25B8.17.1 | 1 | 1 | 1 | 241 | 65 | forward | protein coding | No | 1194 | SPAC25B8.17 | intramembrane aspartyl protease of the perinuclear ER membrane Ypf1 (predicted) | intramembrane aspartyl protease of the perinuclear ER membrane Ypf1 (predicted) | 2542712 | Q9UTA3 | I | Spom972h_chrI:4,190,288..4,191,481(+) | Spom972h_chrI:4190353..4191240(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 148 | OG6_102328 | 0 | 295 | 888 | 33233 | 8.64 | 7 | | | GO:0005794;GO:0016021 | Golgi apparatus;integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | GO:0005783;GO:0071458;GO:0071556;GO:0016021;GO:1990578 | endoplasmic reticulum;integral component of cytoplasmic side of endoplasmic reticulum membrane;integral component of lumenal side of endoplasmic reticulum membrane;integral component of membrane;perinuclear endoplasmic reticulum membrane | GO:0042500 | aspartic endopeptidase activity, intramembrane cleaving | GO:0033619;GO:0006465;GO:0030433 | membrane protein proteolysis;signal peptide processing;ubiquitin-dependent ERAD pathway | 3.4.23.- (Aspartic endopeptidases.) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC25B8.17ORintramembrane aspartyl protease of the perinuclear ER membrane Ypf1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC25B8.17 OR intramembrane aspartyl protease of the perinuclear ER membrane Ypf1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC25G10.08 | SPAC25G10.08.1 | 1 | 1 | 1 | 305 | 44 | forward | protein coding | No | 2527 | SPAC25G10.08 | translation initiation factor eIF3b (p84) | translation initiation factor eIF3b (p84) | 2542090 | Q10425 | I | Spom972h_chrI:4,310,535..4,313,061(+) | Spom972h_chrI:4310579..4312756(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 159 | OG6_101924 | 0 | 725 | 2178 | 84034 | 5.14 | 0 | | | GO:0033290;GO:0005852 | eukaryotic 48S preinitiation complex;eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003676;GO:0003743;GO:0031369 | RNA binding;nucleic acid binding;translation initiation factor activity;translation initiation factor binding | GO:0001732;GO:0006413 | formation of cytoplasmic translation initiation complex;translational initiation | GO:0005737;GO:0010494;GO:0005829;GO:0016282;GO:0005852;GO:0071540;GO:0071541 | cytoplasm;cytoplasmic stress granule;cytosol;eukaryotic 43S preinitiation complex;eukaryotic translation initiation factor 3 complex;eukaryotic translation initiation factor 3 complex, eIF3e;eukaryotic translation initiation factor 3 complex, eIF3m | GO:0003743 | translation initiation factor activity | GO:0006413 | translational initiation | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC25G10.08ORtranslation initiation factor eIF3b (p84)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC25G10.08 OR translation initiation factor eIF3b (p84) AND Schizosaccharomyces pombe 972h- |
|
SPAC25H1.04 | SPAC25H1.04.1 | 1 | 1 | 1 | 82 | | forward | protein coding | No | 817 | SPAC25H1.04 | ubiquitin-fold modifier-specific protease (predicted) | ubiquitin-fold modifier-specific protease (predicted) | 2542717 | O13979 | I | Spom972h_chrI:2,529,085..2,529,901(+) | Spom972h_chrI:2529085..2529819(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 113 | OG6_105237 | 0 | 244 | 735 | 28083 | 8.12 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | | | GO:0005737 | cytoplasm | GO:1990380 | Lys48-specific deubiquitinase activity | GO:0071108 | protein K48-linked deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 2.7.4.3 (Adenylate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC25H1.04ORubiquitin-fold modifier-specific protease (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC25H1.04 OR ubiquitin-fold modifier-specific protease (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC26A3.01 | SPAC26A3.01.1 | 1 | 1 | 1 | 444 | 128 | forward | protein coding | No | 2174 | SPAC26A3.01 | aspartic protease Sxa1 | aspartic protease Sxa1 | 3361468 | P32834 | I | Spom972h_chrI:3,332,541..3,334,714(+) | Spom972h_chrI:3332669..3334270(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 406 | OG6_114704 | 1 | 533 | 1602 | 56852 | 4.07 | 1 | NN: MKASFFVFAISALQALQASVASAY, HMM: MKASFFVFAISALQALQASVASAY | NN Sum: 4, NN D: .68, HMM Prob: 1 | | | | | | | GO:0031362;GO:0005783;GO:0005886 | anchored component of external side of plasma membrane;endoplasmic reticulum;plasma membrane | GO:0004190;GO:0008233 | aspartic-type endopeptidase activity;peptidase activity | GO:0030163;GO:0006508 | protein catabolic process;proteolysis | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC26A3.01ORaspartic protease Sxa1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC26A3.01 OR aspartic protease Sxa1 AND Schizosaccharomyces pombe 972h- |
|
SPAC27F1.03c | SPAC27F1.03c.1 | 1 | 1 | 1 | 91 | 104 | reverse | protein coding | No | 864 | SPAC27F1.03c | ubiquitin C-terminal hydrolase Uch1 | ubiquitin C-terminal hydrolase Uch1 | 2541733 | Q10171 | I | Spom972h_chrI:4,320,716..4,321,579(-) | Spom972h_chrI:4320807..4321475(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 236 | OG6_101218 | 0 | 222 | 669 | 24912 | 4.47 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829;GO:0005634 | cytoplasm;cytosol;nucleus | GO:0019784;GO:0004843 | NEDD8-specific protease activity;thiol-dependent ubiquitin-specific protease activity | GO:0000338;GO:0016579 | protein deneddylation;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC27F1.03cORubiquitin C-terminal hydrolase Uch1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC27F1.03c OR ubiquitin C-terminal hydrolase Uch1 AND Schizosaccharomyces pombe 972h- |
|
SPAC2H10.02c | SPAC2H10.02c.1 | 2 | 2 | 1 | 129 | 84 | reverse | protein coding | No | 855 | SPAC2H10.02c | 26S proteasome regulatory particle assembly protein Nas2 (predicted) | 26S proteasome regulatory particle assembly protein Nas2 (predicted) | 2543070 | O94393 | I | Spom972h_chrI:5,276,066..5,276,991(-) | Spom972h_chrI:5276195..5276907(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 151 | OG6_102356 | 0 | 213 | 642 | 23891 | 5.02 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737;GO:0005829;GO:0005634;GO:0008540 | cytoplasm;cytosol;nucleus;proteasome regulatory particle, base subcomplex | GO:0003674 | molecular_function | GO:0070682 | proteasome regulatory particle assembly | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC2H10.02cOR26S proteasome regulatory particle assembly protein Nas2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC2H10.02c OR 26S proteasome regulatory particle assembly protein Nas2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC31A2.04c | SPAC31A2.04c.1 | 1 | 1 | 1 | 182 | 87 | reverse | protein coding | No | 854 | SPAC31A2.04c | 20S proteasome complex subunit beta 4 Pre1 (predicted) | 20S proteasome complex subunit beta 4 Pre1 (predicted) | 2543122 | Q09720 | I | Spom972h_chrI:390,407..391,260(-) | Spom972h_chrI:390589..391173(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 153 | OG6_102061 | 0 | 194 | 585 | 21967 | 7.20 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005829;GO:0005635;GO:0005634;GO:0005839;GO:0019774 | cytoplasm;cytosol;nuclear envelope;nucleus;proteasome core complex;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC31A2.04cOR20S proteasome complex subunit beta 4 Pre1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC31A2.04c OR 20S proteasome complex subunit beta 4 Pre1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC31G5.13 | SPAC31G5.13.1 | 1 | 1 | 1 | 402 | 347 | forward | protein coding | No | 1676 | SPAC31G5.13 | 19S proteasome regulatory subunit Rpn11 | 19S proteasome regulatory subunit Rpn11 | 2543040 | P41878 | I | Spom972h_chrI:3,010,632..3,012,307(+) | Spom972h_chrI:3010979..3011905(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 155 | OG6_101835 | 0 | 308 | 927 | 34571 | 6.74 | 0 | | | | | GO:0046872;GO:0005515 | metal ion binding;protein binding | | | GO:0005737;GO:0034399;GO:0031595;GO:0005634;GO:0008541 | cytoplasm;nuclear periphery;nuclear proteasome complex;nucleus;proteasome regulatory particle, lid subcomplex | GO:0008237;GO:0070628;GO:0005515;GO:0004843 | metallopeptidase activity;proteasome binding;protein binding;thiol-dependent ubiquitin-specific protease activity | GO:0045842;GO:0043161;GO:0016579 | positive regulation of mitotic metaphase/anaphase transition;proteasome-mediated ubiquitin-dependent protein catabolic process;protein deubiquitination | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC31G5.13OR19S proteasome regulatory subunit Rpn11ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC31G5.13 OR 19S proteasome regulatory subunit Rpn11 AND Schizosaccharomyces pombe 972h- |
|
SPAC323.02c | SPAC323.02c.1 | 4 | 4 | 1 | 135 | 55 | reverse | protein coding | No | 934 | SPAC323.02c | 20S proteasome complex subunit alpha 5, Pup2 (predicted) | 20S proteasome complex subunit alpha 5, Pup2 (predicted) | 2543205 | Q9UT97 | I | Spom972h_chrI:3,909,254..3,910,426(-) | Spom972h_chrI:3909389..3910371(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 158 | OG6_101621 | 0 | 247 | 744 | 27572 | 4.68 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0043161;GO:0051603;GO:0006511 | proteasome-mediated ubiquitin-dependent protein catabolic process;proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829;GO:0005634;GO:0005839;GO:0019773 | cytoplasm;cytosol;nucleus;proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC323.02cOR20S proteasome complex subunit alpha 5, Pup2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC323.02c OR 20S proteasome complex subunit alpha 5, Pup2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC328.06 | SPAC328.06.1 | 2 | 2 | 1 | 265 | 132 | forward | protein coding | No | 3823 | SPAC328.06 | ubiquitin C-terminal hydrolase Ubp2 | ubiquitin C-terminal hydrolase Ubp2 | 2542059 | Q9P3U0 | I | Spom972h_chrI:3,487,193..3,491,099(+) | Spom972h_chrI:3487325..3490834(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 135 | OG6_116931 | 0 | 1141 | 3426 | 130295 | 4.88 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0061578;GO:0004197;GO:0004843 | Lys63-specific deubiquitinase activity;cysteine-type endopeptidase activity;thiol-dependent ubiquitin-specific protease activity | GO:0034599;GO:0016579;GO:0031647;GO:0043162 | cellular response to oxidative stress;protein deubiquitination;regulation of protein stability;ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC328.06ORubiquitin C-terminal hydrolase Ubp2ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC328.06 OR ubiquitin C-terminal hydrolase Ubp2 AND Schizosaccharomyces pombe 972h- |
|
SPAC3A11.10c | SPAC3A11.10c.1 | 1 | 1 | 1 | 262 | 239 | forward | protein coding | No | 1731 | SPAC3A11.10c | dipeptidyl peptidase (predicted) | dipeptidyl peptidase (predicted) | 2543080 | O14124 | I | Spom972h_chrI:3,448,125..3,449,855(+) | Spom972h_chrI:3448364..3449593(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 195 | OG6_102004 | 1 | 409 | 1230 | 46047 | 6.68 | 1 | | | | | GO:0016805;GO:0046872 | dipeptidase activity;metal ion binding | GO:0006508 | proteolysis | GO:0005794 | Golgi apparatus | GO:0070573 | metallodipeptidase activity | GO:0008150 | biological_process | 3.4.13.19 (Membrane dipeptidase) | 3.4.13.19 (Membrane dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC3A11.10cORdipeptidyl peptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC3A11.10c OR dipeptidyl peptidase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC3A11.12c | SPAC3A11.12c.1 | 2 | 2 | 1 | 572 | 14 | forward | protein coding | No | 1903 | SPAC3A11.12c | 19S proteasome regulatory subunit Rpt5 (predicted) | 19S proteasome regulatory subunit Rpt5 (predicted) | 3361462 | O14126 | I | Spom972h_chrI:3,443,930..3,446,017(+) | Spom972h_chrI:3443944..3445445(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 152 | OG6_101915 | 0 | 438 | 1317 | 48835 | 4.72 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005829;GO:0005634;GO:0008540 | cytosol;nucleus;proteasome regulatory particle, base subcomplex | GO:0005524;GO:0036402 | ATP binding;proteasome-activating ATPase activity | GO:0045899;GO:0045842;GO:0043161 | positive regulation of RNA polymerase II transcriptional preinitiation complex assembly;positive regulation of mitotic metaphase/anaphase transition;proteasome-mediated ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC3A11.12cOR19S proteasome regulatory subunit Rpt5 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC3A11.12c OR 19S proteasome regulatory subunit Rpt5 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC3H1.02c | SPAC3H1.02c.1 | 1 | 1 | 1 | 99 | 254 | reverse | protein coding | No | 3464 | SPAC3H1.02c | metallopeptidase (predicted) | metallopeptidase (predicted) | 2543450 | Q10068 | I | Spom972h_chrI:1,931,489..1,934,952(-) | Spom972h_chrI:1931588..1934698(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 167 | OG6_105738 | 0 | 1036 | 3111 | 117420 | 4.72 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005829;GO:0005634 | cytosol;nucleus | GO:0004222 | metalloendopeptidase activity | GO:0035694;GO:0006508 | mitochondrial protein catabolic process;proteolysis | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC3H1.02cORmetallopeptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC3H1.02c OR metallopeptidase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC3H1.05 | SPAC3H1.05.1 | 2 | 2 | 1 | 143 | 621 | forward | protein coding | No | 2189 | SPAC3H1.05 | CAAX prenyl protease (predicted) | CAAX prenyl protease (predicted) | 2543456 | Q10071 | I | Spom972h_chrI:1,938,279..1,940,537(+) | Spom972h_chrI:1938900..1940394(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 168 | OG6_101632 | 0 | 474 | 1425 | 54000 | 9.17 | 3 | | | | | GO:0046872;GO:0004222 | metal ion binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005783;GO:0030176 | endoplasmic reticulum;integral component of endoplasmic reticulum membrane | GO:0004222 | metalloendopeptidase activity | GO:0071586 | CAAX-box protein processing | 3.4.24.84 (Ste24 endopeptidase) | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC3H1.05ORCAAX prenyl protease (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC3H1.05 OR CAAX prenyl protease (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC3H1.10 | SPAC3H1.10.1 | 1 | 1 | 1 | 508 | 512 | forward | protein coding | No | 2265 | SPAC3H1.10 | phytochelatin synthetase | phytochelatin synthetase | 2543367 | Q10075 | I | Spom972h_chrI:1,949,244..1,951,508(+) | Spom972h_chrI:1949756..1951000(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 49 | OG6_106155 | 0 | 414 | 1245 | 46740 | 8.35 | 0 | | | | | GO:0016756;GO:0046872 | glutathione gamma-glutamylcysteinyltransferase activity;metal ion binding | GO:0046938;GO:0010038 | phytochelatin biosynthetic process;response to metal ion | GO:0005737;GO:0005829;GO:0005634 | cytoplasm;cytosol;nucleus | GO:0046870;GO:0016756 | cadmium ion binding;glutathione gamma-glutamylcysteinyltransferase activity | GO:0098849;GO:0071276;GO:0010273;GO:0046938 | cellular detoxification of cadmium ion;cellular response to cadmium ion;detoxification of copper ion;phytochelatin biosynthetic process | 2.3.2.15 (Glutathione gamma-glutamylcysteinyltransferase) | 2.3.2.15 (Glutathione gamma-glutamylcysteinyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC3H1.10ORphytochelatin synthetaseANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC3H1.10 OR phytochelatin synthetase AND Schizosaccharomyces pombe 972h- |
|
SPAC4A8.04 | SPAC4A8.04.1 | 1 | 1 | 1 | 228 | 535 | forward | protein coding | No | 2167 | SPAC4A8.04 | vacuolar serine protease Isp6 | vacuolar serine protease Isp6 | 2543097 | P40903 | I | Spom972h_chrI:2,544,815..2,546,981(+) | Spom972h_chrI:2545350..2546753(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 1003 | OG6_100121 | 1 | 467 | 1404 | 49366 | 5.19 | 0 | HMM: MRIPYSNLFSAAAGLALFASTACAA, NN: MRIPYSNLFSAAAGLALFASTACAA | NN Sum: 4, NN D: .79, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005794;GO:0005615;GO:0000324 | Golgi apparatus;extracellular space;fungal-type vacuole | GO:0004175;GO:0008233;GO:0004252 | endopeptidase activity;peptidase activity;serine-type endopeptidase activity | GO:0006914;GO:0000747;GO:0007033 | autophagy;conjugation with cellular fusion;vacuole organization | 3.4.21.- (Serine endopeptidases.) | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC4A8.04ORvacuolar serine protease Isp6ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC4A8.04 OR vacuolar serine protease Isp6 AND Schizosaccharomyces pombe 972h- |
|
SPAC4A8.13c | SPAC4A8.13c.1 | 1 | 1 | 1 | 360 | 32 | reverse | protein coding | No | 1211 | SPAC4A8.13c | 20S proteasome complex subunit beta 5 | 20S proteasome complex subunit beta 5 | 2543623 | P30655 | I | Spom972h_chrI:2,574,746..2,575,956(-) | Spom972h_chrI:2575106..2575924(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 151 | OG6_100897 | 0 | 272 | 819 | 29986 | 6.95 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005829;GO:0005635;GO:0005634;GO:0005839;GO:0019774 | cytoplasm;cytosol;nuclear envelope;nucleus;proteasome core complex;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC4A8.13cOR20S proteasome complex subunit beta 5ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC4A8.13c OR 20S proteasome complex subunit beta 5 AND Schizosaccharomyces pombe 972h- |
|
SPAC4F10.02 | SPAC4F10.02.1 | 2 | 2 | 1 | 142 | 50 | forward | protein coding | No | 1596 | SPAC4F10.02 | aspartyl metalloaminopeptidase Aap1 | aspartyl metalloaminopeptidase Aap1 | 2543605 | O36014 | I | Spom972h_chrI:4,832,879..4,834,570(+) | Spom972h_chrI:4832929..4834428(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 155 | OG6_102047 | 0 | 467 | 1404 | 51740 | 5.73 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737;GO:0005829;GO:0005576;GO:0000324 | cytoplasm;cytosol;extracellular region;fungal-type vacuole | GO:0070006 | metalloaminopeptidase activity | GO:0061077;GO:0006508 | chaperone-mediated protein folding;proteolysis | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC4F10.02ORaspartyl metalloaminopeptidase Aap1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC4F10.02 OR aspartyl metalloaminopeptidase Aap1 AND Schizosaccharomyces pombe 972h- |
|
SPAC521.02 | SPAC521.02.1 | 1 | 1 | 1 | 81 | 36 | forward | protein coding | No | 969 | SPAC521.02 | WLM domain protein | WLM domain protein | 2543468 | Q9P7B5 | I | Spom972h_chrI:843,197..844,165(+) | Spom972h_chrI:843233..844084(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 52 | OG6_126881 | 0 | 283 | 852 | 32359 | 10.03 | 1 | NN: MIAILYLYYILTTSILLSVSF, HMM: MIAILYLYYILTTSILLSVSF | NN Sum: 3, NN D: .6, HMM Prob: .29 | | | | | | | GO:0005634 | nucleus | GO:0004222;GO:0008270 | metalloendopeptidase activity;zinc ion binding | GO:0019985 | translesion synthesis | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC521.02ORWLM domain proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC521.02 OR WLM domain protein AND Schizosaccharomyces pombe 972h- |
|
SPAC56E4.04c | SPAC56E4.04c.1 | 2 | 2 | 1 | 379 | | reverse | protein coding | No | 7222 | SPAC56E4.04c | acetyl-CoA/biotin carboxylase | acetyl-CoA/biotin carboxylase | 2543344 | P78820 | I | Spom972h_chrI:1,245,716..1,253,559(-) | Spom972h_chrI:1246095..1253559(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 183 | OG6_101052 | 0 | 2280 | 6843 | 256840 | 6.39 | 0 | | | | | GO:0005524;GO:0003989;GO:0016874;GO:0046872 | ATP binding;acetyl-CoA carboxylase activity;ligase activity;metal ion binding | GO:0006633;GO:2001295 | fatty acid biosynthetic process;malonyl-CoA biosynthetic process | GO:0005737;GO:0005829;GO:0000329 | cytoplasm;cytosol;fungal-type vacuole membrane | GO:0005524;GO:0003989;GO:0004075 | ATP binding;acetyl-CoA carboxylase activity;biotin carboxylase activity | | | 6.3.4.14 (Biotin carboxylase);6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC56E4.04cORacetyl-CoA/biotin carboxylaseANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC56E4.04c OR acetyl-CoA/biotin carboxylase AND Schizosaccharomyces pombe 972h- |
|
SPAC56E4.06c | SPAC56E4.06c.1 | 1 | 1 | 1 | 190 | 386 | reverse | protein coding | No | 2412 | SPAC56E4.06c | gamma-glutamyltranspeptidase Ggt2 | gamma-glutamyltranspeptidase Ggt2 | 2543110 | O14194 | I | Spom972h_chrI:1,256,376..1,258,787(-) | Spom972h_chrI:1256566..1258401(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 184 | OG6_100578 | 1 | 611 | 1836 | 67824 | 7.43 | 1 | | | GO:0016021 | integral component of membrane | GO:0036374;GO:0016746 | glutathione hydrolase activity;transferase activity, transferring acyl groups | GO:0006751 | glutathione catabolic process | GO:0000324 | fungal-type vacuole | GO:0036374;GO:0000048 | glutathione hydrolase activity;peptidyltransferase activity | GO:0006520;GO:1990748;GO:0019344;GO:0006536;GO:0006751;GO:0006749 | cellular amino acid metabolic process;cellular detoxification;cysteine biosynthetic process;glutamate metabolic process;glutathione catabolic process;glutathione metabolic process | 2.3.2.2 (Gamma-glutamyltransferase);3.4.19.13 (Glutathione gamma-glutamate hydrolase) | 2.3.2.2 (Gamma-glutamyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC56E4.06cORgamma-glutamyltranspeptidase Ggt2ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC56E4.06c OR gamma-glutamyltranspeptidase Ggt2 AND Schizosaccharomyces pombe 972h- |
|
SPAC56F8.08 | SPAC56F8.08.1 | 2 | 2 | 1 | 83 | | forward | protein coding | No | 1082 | SPAC56F8.08 | UBA domain protein Mud1 | UBA domain protein Mud1 | 3361477 | Q10256 | I | Spom972h_chrI:1,139,130..1,140,325(+) | Spom972h_chrI:1139130..1140242(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 152 | OG6_101685 | 0 | 332 | 999 | 35869 | 4.59 | 0 | | | | | GO:0004190;GO:0005515;GO:0043130 | aspartic-type endopeptidase activity;protein binding;ubiquitin binding | GO:0006508 | proteolysis | GO:0005886 | plasma membrane | GO:0000149;GO:0031593 | SNARE binding;polyubiquitin modification-dependent protein binding | GO:0043161;GO:0017157 | proteasome-mediated ubiquitin-dependent protein catabolic process;regulation of exocytosis | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC56F8.08ORUBA domain protein Mud1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC56F8.08 OR UBA domain protein Mud1 AND Schizosaccharomyces pombe 972h- |
|
SPAC56F8.11 | SPAC56F8.11.1 | 3 | 3 | 1 | 442 | 237 | forward | protein coding | No | 1237 | SPAC56F8.11 | signal peptidase subunit Spc3 (predicted) | signal peptidase subunit Spc3 (predicted) | 2543318 | Q10259 | I | Spom972h_chrI:1,145,305..1,146,800(+) | Spom972h_chrI:1145542..1146358(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 153 | OG6_102447 | 0 | 185 | 558 | 21642 | 9.18 | 1 | | | GO:0016021;GO:0031090;GO:0005787 | integral component of membrane;organelle membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | GO:0008233 | peptidase activity | GO:0045047;GO:0006465 | protein targeting to ER;signal peptide processing | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC56F8.11ORsignal peptidase subunit Spc3 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC56F8.11 OR signal peptidase subunit Spc3 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC5H10.02c | SPAC5H10.02c.1 | 1 | 1 | 1 | 175 | 1396 | reverse | protein coding | No | 2294 | SPAC5H10.02c | glyoxylase III Hsp3102 | glyoxylase III Hsp3102 | 2541799 | Q09675 | I | Spom972h_chrI:148,038..150,331(-) | Spom972h_chrI:148213..148935(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 278 | OG6_105123 | 3 | 240 | 723 | 26116 | 7.75 | 0 | | | | | | | | | GO:0005737;GO:0005829;GO:0005634 | cytoplasm;cytosol;nucleus | GO:0019172 | glyoxalase III activity | GO:1990748 | cellular detoxification | 4.2.1.130 (D-lactate dehydratase) | 4.2.1.130 (D-lactate dehydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC5H10.02cORglyoxylase III Hsp3102ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC5H10.02c OR glyoxylase III Hsp3102 AND Schizosaccharomyces pombe 972h- |
|
SPAC607.06c | SPAC607.06c.1 | 3 | 3 | 1 | 90 | 22 | reverse | protein coding | No | 1951 | SPAC607.06c | metallopeptidase (predicted) | metallopeptidase (predicted) | 2543169 | Q9US12 | I | Spom972h_chrI:2,045,120..2,047,166(-) | Spom972h_chrI:2045210..2047144(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 180 | OG6_107913 | 0 | 612 | 1839 | 68570 | 6.42 | 0 | | | | | GO:0046872 | metal ion binding | | | GO:0032153;GO:0005829;GO:0005634 | cell division site;cytosol;nucleus | GO:0008237 | metallopeptidase activity | GO:0008150 | biological_process | 3.4.24.- (Metalloendopeptidases.) | 2.7.8.8 (CDP-diacylglycerol--serine O-phosphatidyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC607.06cORmetallopeptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC607.06c OR metallopeptidase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC607.08c | SPAC607.08c.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1740 | SPAC607.08c | DUF726 family protein | DUF726 family protein | 2543150 | Q9US10 | I | Spom972h_chrI:2,048,421..2,050,160(-) | Spom972h_chrI:2048421..2050160(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 321 | OG6_102131 | 1 | 579 | 1740 | 63630 | 4.76 | 2 | | | GO:0016021 | integral component of membrane | | | | | GO:0005829;GO:0005634 | cytosol;nucleus | GO:0016298 | lipase activity | GO:0016192 | vesicle-mediated transport | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC607.08cORDUF726 family proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC607.08c OR DUF726 family protein AND Schizosaccharomyces pombe 972h- |
|
SPAC637.10c | SPAC637.10c.1 | 4 | 4 | 1 | 170 | 126 | reverse | protein coding | No | 1028 | SPAC637.10c | 19S proteasome regulatory subunit Rpn10 | 19S proteasome regulatory subunit Rpn10 | 2543682 | O94444 | I | Spom972h_chrI:4,557,551..4,558,762(-) | Spom972h_chrI:4557721..4558636(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 150 | OG6_102002 | 0 | 243 | 732 | 27139 | 4.70 | 0 | | | | | | | | | GO:0005829;GO:0005634;GO:0008540;GO:0008541 | cytosol;nucleus;proteasome regulatory particle, base subcomplex;proteasome regulatory particle, lid subcomplex | GO:0036435;GO:0031593;GO:0005515;GO:0043130 | K48-linked polyubiquitin modification-dependent protein binding;polyubiquitin modification-dependent protein binding;protein binding;ubiquitin binding | GO:0045842;GO:0043248;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasome assembly;proteasome-mediated ubiquitin-dependent protein catabolic process | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC637.10cOR19S proteasome regulatory subunit Rpn10ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC637.10c OR 19S proteasome regulatory subunit Rpn10 AND Schizosaccharomyces pombe 972h- |
|
SPAC664.09 | SPAC664.09.1 | 1 | 1 | 1 | 313 | 576 | forward | protein coding | No | 2782 | SPAC664.09 | gamma-glutamyltranspeptidase Ggt1 | gamma-glutamyltranspeptidase Ggt1 | 2543536 | Q9US04 | I | Spom972h_chrI:1,718,920..1,721,701(+) | Spom972h_chrI:1719496..1721388(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 184 | OG6_100578 | 1 | 630 | 1893 | 68721 | 6.37 | 1 | | | GO:0016021 | integral component of membrane | GO:0036374;GO:0016746 | glutathione hydrolase activity;transferase activity, transferring acyl groups | GO:0006751 | glutathione catabolic process | GO:0005783;GO:0000324 | endoplasmic reticulum;fungal-type vacuole | GO:0036374;GO:0000048 | glutathione hydrolase activity;peptidyltransferase activity | GO:0006520;GO:1990748;GO:0019344;GO:0006536;GO:0006751;GO:0006749 | cellular amino acid metabolic process;cellular detoxification;cysteine biosynthetic process;glutamate metabolic process;glutathione catabolic process;glutathione metabolic process | 2.3.2.2 (Gamma-glutamyltransferase);3.4.19.13 (Glutathione gamma-glutamate hydrolase) | 2.3.2.2 (Gamma-glutamyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC664.09ORgamma-glutamyltranspeptidase Ggt1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC664.09 OR gamma-glutamyltranspeptidase Ggt1 AND Schizosaccharomyces pombe 972h- |
|
SPAC6F6.13c | SPAC6F6.13c.1 | 1 | 1 | 1 | 180 | 90 | reverse | protein coding | No | 2607 | SPAC6F6.13c | DUF726 family protein | DUF726 family protein | 2542120 | O14244 | I | Spom972h_chrI:2,756,318..2,758,924(-) | Spom972h_chrI:2756498..2758834(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 321 | OG6_102131 | 1 | 778 | 2337 | 86128 | 4.83 | 2 | | | GO:0016021 | integral component of membrane | | | | | GO:0005794;GO:0005737 | Golgi apparatus;cytoplasm | GO:0016787 | hydrolase activity | GO:0008150 | biological_process | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC6F6.13cORDUF726 family proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC6F6.13c OR DUF726 family protein AND Schizosaccharomyces pombe 972h- |
|
SPAC6G10.04c | SPAC6G10.04c.1 | 4 | 4 | 1 | 207 | 52 | reverse | protein coding | No | 1078 | SPAC6G10.04c | 20S proteasome complex subunit alpha 6 subunit Pre5 (predicted) | 20S proteasome complex subunit alpha 6 subunit Pre5 (predicted) | 2542559 | O14250 | I | Spom972h_chrI:3,220,849..3,222,193(-) | Spom972h_chrI:3221056..3222141(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 156 | OG6_102143 | 0 | 272 | 819 | 30110 | 5.09 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829;GO:0005634;GO:0005839;GO:0019773 | cytoplasm;cytosol;nucleus;proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC6G10.04cOR20S proteasome complex subunit alpha 6 subunit Pre5 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC6G10.04c OR 20S proteasome complex subunit alpha 6 subunit Pre5 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAC6G9.08 | SPAC6G9.08.1 | 1 | 1 | 1 | 1115 | 137 | forward | protein coding | No | 2659 | SPAC6G9.08 | ubiquitin C-terminal hydrolase Ubp6 | ubiquitin C-terminal hydrolase Ubp6 | 2541819 | Q92353 | I | Spom972h_chrI:3,259,564..3,262,222(+) | Spom972h_chrI:3259701..3261107(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 155 | OG6_101892 | 0 | 468 | 1407 | 52316 | 5.01 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005730;GO:0005654;GO:0005634 | nucleolus;nucleoplasm;nucleus | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0043161;GO:0016579 | proteasome-mediated ubiquitin-dependent protein catabolic process;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC6G9.08ORubiquitin C-terminal hydrolase Ubp6ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC6G9.08 OR ubiquitin C-terminal hydrolase Ubp6 AND Schizosaccharomyces pombe 972h- |
|
SPAC959.06c | SPAC959.06c.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 678 | SPAC959.06c | conserved fungal protein | conserved fungal protein | 14218018 | P0CS92 | I | Spom972h_chrI:3,398,024..3,398,701(-) | Spom972h_chrI:3398024..3398701(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 33 | OG6_108842 | 0 | 225 | 678 | 25215 | 8.75 | 1 | | | | | | | | | GO:0005575 | cellular_component | GO:0003824 | catalytic activity | GO:0008150 | biological_process | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC959.06cORconserved fungal proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC959.06c OR conserved fungal protein AND Schizosaccharomyces pombe 972h- |
|
SPAC9G1.06c | SPAC9G1.06c.1 | 2 | 2 | 1 | 2610 | 99 | reverse | protein coding | No | 5370 | SPAC9G1.06c | cytokinesis protein Cyk3 (predicted) | cytokinesis protein Cyk3 (predicted) | 2542740 | O14302 | I | Spom972h_chrI:1,976,754..1,982,206(-) | Spom972h_chrI:1979364..1982107(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 97 | OG6_129980 | 0 | 886 | 2661 | 98262 | 9.75 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005826;GO:0120105;GO:0051285;GO:0032153;GO:0009986;GO:0051286;GO:0000935 | actomyosin contractile ring;actomyosin contractile ring, intermediate layer;cell cortex of cell tip;cell division site;cell surface;cell tip;division septum | GO:0003674 | molecular_function | GO:1902404;GO:0008360 | mitotic actomyosin contractile ring contraction;regulation of cell shape | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPAC9G1.06cORcytokinesis protein Cyk3 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAC9G1.06c OR cytokinesis protein Cyk3 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPACUNK4.08 | SPACUNK4.08.1 | 1 | 1 | 1 | 121 | 412 | reverse | protein coding | No | 2915 | SPACUNK4.08 | dipeptidyl peptidase (predicted) | dipeptidyl peptidase (predicted) | 2542415 | O14073 | I | Spom972h_chrI:2,895,098..2,898,012(-) | Spom972h_chrI:2895219..2897600(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 183 | OG6_100574 | 0 | 793 | 2382 | 91303 | 4.76 | 1 | | | GO:0016021 | integral component of membrane | GO:0004252;GO:0008236 | serine-type endopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | GO:0008239 | dipeptidyl-peptidase activity | GO:0016485 | protein processing | 3.4.14.- (Dipeptidyl-peptidases and tripeptidyl-peptidases.) | 3.4.14.5 (Dipeptidyl-peptidase IV) | https://pubmed.ncbi.nlm.nih.gov/?term=SPACUNK4.08ORdipeptidyl peptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPACUNK4.08 OR dipeptidyl peptidase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPACUNK4.12c | SPACUNK4.12c.1 | 1 | 1 | 1 | 147 | 79 | forward | protein coding | No | 3136 | SPACUNK4.12c | insulinase pombe homologue 1 | insulinase pombe homologue 1 | 2542436 | O14077 | I | Spom972h_chrI:2,886,960..2,890,095(+) | Spom972h_chrI:2887039..2889948(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 314 | OG6_100422 | 0 | 969 | 2910 | 112143 | 5.82 | 0 | | | | | GO:0003824;GO:0046872;GO:0004222 | catalytic activity;metal ion binding;metalloendopeptidase activity | | | GO:0005829;GO:0005739 | cytosol;mitochondrion | | | GO:0071432;GO:0006508;GO:0051603 | peptide mating pheromone maturation involved in positive regulation of conjugation with cellular fusion;proteolysis;proteolysis involved in cellular protein catabolic process | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=SPACUNK4.12cORinsulinase pombe homologue 1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPACUNK4.12c OR insulinase pombe homologue 1 AND Schizosaccharomyces pombe 972h- |
|
SPAP14E8.04 | SPAP14E8.04.1 | 1 | 1 | 1 | 162 | 135 | forward | protein coding | No | 1311 | SPAP14E8.04 | metallopeptidase Oma1 (predicted) | metallopeptidase Oma1 (predicted) | 2541915 | Q9P7G4 | I | Spom972h_chrI:1,926,604..1,927,914(+) | Spom972h_chrI:1926739..1927752(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 178 | OG6_102706 | 0 | 337 | 1014 | 38610 | 9.60 | 1 | | | GO:0016021 | integral component of membrane | GO:0046872;GO:0004222 | metal ion binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005743;GO:0005739 | mitochondrial inner membrane;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0006515 | protein quality control for misfolded or incompletely synthesized proteins | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAP14E8.04ORmetallopeptidase Oma1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAP14E8.04 OR metallopeptidase Oma1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPAP8A3.12c | SPAP8A3.12c.1 | 1 | 1 | 1 | 134 | | reverse | protein coding | No | 3959 | SPAP8A3.12c | tripeptidyl-peptidase II Tpp2 | tripeptidyl-peptidase II Tpp2 | 2543179 | Q9UT05 | I | Spom972h_chrI:5,336,681..5,340,639(-) | Spom972h_chrI:5336815..5340639(-) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 49 | OG6_104037 | 0 | 1274 | 3825 | 142925 | 6.36 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005829;GO:0030173;GO:0016020;GO:0005802 | cytosol;integral component of Golgi membrane;membrane;trans-Golgi network | GO:0004252;GO:0008240 | serine-type endopeptidase activity;tripeptidyl-peptidase activity | GO:0008150;GO:0016485 | biological_process;protein processing | 3.4.14.10 (Tripeptidyl-peptidase II) | 3.4.14.10 (Tripeptidyl-peptidase II) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAP8A3.12cORtripeptidyl-peptidase II Tpp2ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAP8A3.12c OR tripeptidyl-peptidase II Tpp2 AND Schizosaccharomyces pombe 972h- |
|
SPAPYUG7.06 | SPAPYUG7.06.1 | 1 | 1 | 1 | 138 | 53 | forward | protein coding | No | 797 | SPAPYUG7.06 | PPPDE peptidase family (predicted) | PPPDE peptidase family (predicted) | 2542933 | Q8X1T0 | I | Spom972h_chrI:4,754,130..4,754,926(+) | Spom972h_chrI:4754183..4754788(+) | Spom972h_chrI | Schizosaccharomyces pombe 972h- | 68 | OG6_101256 | 0 | 201 | 606 | 21951 | 6.00 | 0 | | | | | | | | | GO:0005829 | cytosol | GO:0101005 | ubiquitinyl hydrolase activity | GO:0016926;GO:0016579 | protein desumoylation;protein deubiquitination | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPAPYUG7.06ORPPPDE peptidase family (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPAPYUG7.06 OR PPPDE peptidase family (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC106.16 | SPBC106.16.1 | 3 | 3 | 1 | 313 | 338 | forward | protein coding | No | 1431 | SPBC106.16 | 20S proteasome complex subunit alpha 4 Pre6 | 20S proteasome complex subunit alpha 4 Pre6 | 2540175 | Q10329 | II | Spom972h_chrII:409,158..410,766(+) | Spom972h_chrII:409496..410453(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 158 | OG6_101207 | 0 | 259 | 780 | 28276 | 7.56 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829;GO:0034399;GO:0005634;GO:0005839;GO:0019773 | cytoplasm;cytosol;nuclear periphery;nucleus;proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC106.16OR20S proteasome complex subunit alpha 4 Pre6ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC106.16 OR 20S proteasome complex subunit alpha 4 Pre6 AND Schizosaccharomyces pombe 972h- |
|
SPBC119.17 | SPBC119.17.1 | 2 | 2 | 1 | 308 | 67 | forward | protein coding | No | 3354 | SPBC119.17 | mitochondrial metalloendopeptidase (predicted) | mitochondrial metalloendopeptidase (predicted) | 2540111 | | II | Spom972h_chrII:750,719..754,123(+) | Spom972h_chrII:750786..753815(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 133 | OG6_101809 | 0 | 992 | 2979 | 111404 | 7.16 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | GO:0005758;GO:0005759;GO:0005739 | mitochondrial intermembrane space;mitochondrial matrix;mitochondrion | GO:0004222;GO:0008237 | metalloendopeptidase activity;metallopeptidase activity | GO:0016485;GO:0006627;GO:0051603 | protein processing;protein processing involved in protein targeting to mitochondrion;proteolysis involved in cellular protein catabolic process | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC119.17ORmitochondrial metalloendopeptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC119.17 OR mitochondrial metalloendopeptidase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC1198.08 | SPBC1198.08.1 | 2 | 2 | 1 | 174 | 58 | forward | protein coding | No | 1663 | SPBC1198.08 | dipeptidase Dug1 (predicted) | dipeptidase Dug1 (predicted) | 2539648 | Q9P6I2 | II | Spom972h_chrII:187,366..189,153(+) | Spom972h_chrII:187424..188979(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 296 | OG6_100503 | 0 | 476 | 1431 | 52840 | 5.24 | 0 | | | | | GO:0016805;GO:0016787;GO:0046872 | dipeptidase activity;hydrolase activity;metal ion binding | GO:0008152 | metabolic process | GO:0005829;GO:0005634 | cytosol;nucleus | GO:0070573 | metallodipeptidase activity | GO:0006751 | glutathione catabolic process | 3.4.13.- (Dipeptidases.) | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC1198.08ORdipeptidase Dug1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC1198.08 OR dipeptidase Dug1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC13E7.11 | SPBC13E7.11.1 | 1 | 1 | 1 | 209 | 243 | forward | protein coding | No | 1349 | SPBC13E7.11 | mitochondrial rhomboid protease (predicted) | mitochondrial rhomboid protease (predicted) | 2540108 | O14364 | II | Spom972h_chrII:3,058,889..3,060,237(+) | Spom972h_chrII:3059132..3060028(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 194 | OG6_101864 | 0 | 298 | 897 | 33576 | 11.17 | 8 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0005743;GO:0005739 | mitochondrial inner membrane;mitochondrion | GO:0004252 | serine-type endopeptidase activity | GO:0007005;GO:0010821;GO:0006465 | mitochondrion organization;regulation of mitochondrion organization;signal peptide processing | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC13E7.11ORmitochondrial rhomboid protease (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC13E7.11 OR mitochondrial rhomboid protease (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC13G1.08c | SPBC13G1.08c.1 | 1 | 1 | 1 | 60 | 475 | reverse | protein coding | No | 2494 | SPBC13G1.08c | Ash2-trithorax family protein | Ash2-trithorax family protein | 2539667 | O60070 | II | Spom972h_chrII:3,738,915..3,741,408(-) | Spom972h_chrII:3738975..3740933(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 137 | OG6_102272 | 0 | 652 | 1959 | 74252 | 6.78 | 0 | | | | | GO:0046872;GO:0005515 | metal ion binding;protein binding | | | GO:0048189;GO:0048188;GO:0000790;GO:0005634 | Lid2 complex;Set1C/COMPASS complex;nuclear chromatin;nucleus | GO:0042800;GO:0044212;GO:0061630 | histone methyltransferase activity (H3-K4 specific);transcription regulatory region DNA binding;ubiquitin protein ligase activity | GO:0070869;GO:0051568;GO:0070647;GO:0006357;GO:0006351 | heterochromatin assembly involved in chromatin silencing;histone H3-K4 methylation;protein modification by small protein conjugation or removal;regulation of transcription by RNA polymerase II;transcription, DNA-templated | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC13G1.08cORAsh2-trithorax family proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC13G1.08c OR Ash2-trithorax family protein AND Schizosaccharomyces pombe 972h- |
|
SPBC14C8.03 | SPBC14C8.03.1 | 1 | 1 | 1 | 424 | 35 | forward | protein coding | No | 1740 | SPBC14C8.03 | methionine aminopeptidase Fma2 (predicted) | methionine aminopeptidase Fma2 (predicted) | 2539692 | O60085 | II | Spom972h_chrII:2,207,697..2,209,436(+) | Spom972h_chrII:2207732..2209012(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 183 | OG6_100815 | 0 | 426 | 1281 | 47270 | 5.81 | 0 | | | | | GO:0004177;GO:0046872;GO:0070006;GO:0008235 | aminopeptidase activity;metal ion binding;metalloaminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005829 | cytosol | | | GO:0035551 | protein initiator methionine removal involved in protein maturation | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC14C8.03ORmethionine aminopeptidase Fma2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC14C8.03 OR methionine aminopeptidase Fma2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC15C4.02 | SPBC15C4.02.1 | 3 | 3 | 1 | 190 | 366 | forward | protein coding | No | 2230 | SPBC15C4.02 | ABC1 kinase family protein, implicted in mitochondrial ergosterol and phospholipd homeostasis | ABC1 kinase family protein, implicted in mitochondrial ergosterol and phospholipd homeostasis | 2539608 | O60111 | II | Spom972h_chrII:2,238,460..2,240,894(+) | Spom972h_chrII:2238826..2240704(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 282 | OG6_100510 | 1 | 557 | 1674 | 64113 | 9.36 | 0 | | | GO:0016021 | integral component of membrane | | | | | GO:0005739 | mitochondrion | GO:0016301 | kinase activity | GO:0007005;GO:0055091 | mitochondrion organization;phospholipid homeostasis | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC15C4.02ORABC1 kinase family protein, implicted in mitochondrial ergosterol and phospholipd homeostasisANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC15C4.02 OR ABC1 kinase family protein, implicted in mitochondrial ergosterol and phospholipd homeostasis AND Schizosaccharomyces pombe 972h- |
|
SPBC1685.03 | SPBC1685.03.1 | 3 | 3 | 1 | 601 | 193 | forward | protein coding | No | 1364 | SPBC1685.03 | signal peptidase subunit Sec11 (predicted) | signal peptidase subunit Sec11 (predicted) | 2539654 | O74323 | II | Spom972h_chrII:499,181..500,762(+) | Spom972h_chrII:499374..500161(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 170 | OG6_100807 | 0 | 189 | 570 | 21402 | 5.25 | 1 | HMM: MQKLSFRQGLAQILNLLLVLSSAY, NN: MQKLSFRQGLAQILNLLLVLSSAYMG | NN Sum: 3, NN D: .61, HMM Prob: .94 | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | GO:0008233 | peptidase activity | GO:0045047;GO:0006465 | protein targeting to ER;signal peptide processing | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC1685.03ORsignal peptidase subunit Sec11 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC1685.03 OR signal peptidase subunit Sec11 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC1685.05 | SPBC1685.05.1 | 1 | 1 | 1 | 140 | 1526 | forward | protein coding | No | 4660 | SPBC1685.05 | serine protease (predicted) | serine protease (predicted) | 2539936 | O74325 | II | Spom972h_chrII:504,397..509,056(+) | Spom972h_chrII:505923..508916(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 237 | OG6_107381 | 1 | 997 | 2994 | 111292 | 6.36 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005829 | cytosol | GO:0004252 | serine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC1685.05ORserine protease (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC1685.05 OR serine protease (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC16C6.07c | SPBC16C6.07c.1 | 3 | 3 | 1 | 178 | 54 | reverse | protein coding | No | 1549 | SPBC16C6.07c | 19S proteasome regulatory subunit Rpt1 (predicted) | 19S proteasome regulatory subunit Rpt1 (predicted) | 2539862 | O42931 | II | Spom972h_chrII:4,341,623..4,343,422(-) | Spom972h_chrII:4341801..4343368(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 158 | OG6_101899 | 0 | 438 | 1317 | 48964 | 4.99 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005829;GO:0005634;GO:0008540 | cytosol;nucleus;proteasome regulatory particle, base subcomplex | GO:0005524;GO:0017025;GO:0036402 | ATP binding;TBP-class protein binding;proteasome-activating ATPase activity | GO:0045899;GO:0045842;GO:0043161 | positive regulation of RNA polymerase II transcriptional preinitiation complex assembly;positive regulation of mitotic metaphase/anaphase transition;proteasome-mediated ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC16C6.07cOR19S proteasome regulatory subunit Rpt1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC16C6.07c OR 19S proteasome regulatory subunit Rpt1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC16D10.03 | SPBC16D10.03.1 | 2 | 2 | 1 | 438 | 246 | forward | protein coding | No | 1725 | SPBC16D10.03 | EKC/KEOPS complex ATPase subunit Pgp2 | EKC/KEOPS complex ATPase subunit Pgp2 | 2540141 | O94637 | II | Spom972h_chrII:3,590,920..3,592,684(+) | Spom972h_chrII:3591166..3592246(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 304 | OG6_100288 | 1 | 346 | 1041 | 37515 | 7.69 | 0 | | | | | GO:0046872 | metal ion binding | | | GO:0000408;GO:0005829;GO:0005634 | EKC/KEOPS complex;cytosol;nucleus | GO:0061711 | N(6)-L-threonylcarbamoyladenine synthase activity | GO:0002949 | tRNA threonylcarbamoyladenosine modification | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC16D10.03OREKC/KEOPS complex ATPase subunit Pgp2ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC16D10.03 OR EKC/KEOPS complex ATPase subunit Pgp2 AND Schizosaccharomyces pombe 972h- |
|
SPBC16D10.08c | SPBC16D10.08c.1 | 1 | 1 | 1 | 94 | 244 | reverse | protein coding | No | 3056 | SPBC16D10.08c | heat shock protein Hsp104 | heat shock protein Hsp104 | 2540026 | O94641 | II | Spom972h_chrII:3,612,265..3,615,320(-) | Spom972h_chrII:3612359..3615076(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 326 | OG6_100223 | 1 | 905 | 2718 | 100505 | 5.53 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0005737;GO:0005829;GO:0005635;GO:0005634 | cytoplasm;cytosol;nuclear envelope;nucleus | GO:0016887;GO:0042623;GO:0051087;GO:0031072;GO:0051787 | ATPase activity;ATPase activity, coupled;chaperone binding;heat shock protein binding;misfolded protein binding | GO:0070370;GO:0071218;GO:0051085;GO:0042026;GO:0043335 | cellular heat acclimation;cellular response to misfolded protein;chaperone cofactor-dependent protein refolding;protein refolding;protein unfolding | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC16D10.08cORheat shock protein Hsp104ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC16D10.08c OR heat shock protein Hsp104 AND Schizosaccharomyces pombe 972h- |
|
SPBC16G5.09 | SPBC16G5.09.1 | 3 | 3 | 1 | 305 | 76 | forward | protein coding | No | 1914 | SPBC16G5.09 | serine carboxypeptidase (predicted) | serine carboxypeptidase (predicted) | 2540202 | O60123 | II | Spom972h_chrII:4,228,741..4,230,768(+) | Spom972h_chrII:4228817..4230463(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 818 | OG6_100109 | 1 | 510 | 1533 | 57643 | 4.41 | 1 | HMM: MISKLLKIVLLTAGVIGNTLAD, NN: MISKLLKIVLLTAGVIGNTLAD | NN Sum: 4, NN D: .78, HMM Prob: .96 | GO:0016021 | integral component of membrane | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | GO:0000324;GO:0005802 | fungal-type vacuole;trans-Golgi network | GO:0004185 | serine-type carboxypeptidase activity | GO:0006915;GO:0051603 | apoptotic process;proteolysis involved in cellular protein catabolic process | 3.4.16.6 (Carboxypeptidase D) | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC16G5.09ORserine carboxypeptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC16G5.09 OR serine carboxypeptidase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC1703.12 | SPBC1703.12.1 | 4 | 4 | 1 | 644 | 114 | forward | protein coding | No | 2516 | SPBC1703.12 | ubiquitin C-terminal hydrolase Ubp9 | ubiquitin C-terminal hydrolase Ubp9 | 2540120 | Q9P7V9 | II | Spom972h_chrII:2,936,097..2,938,762(+) | Spom972h_chrII:2936211..2938118(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 163 | OG6_101733 | 0 | 585 | 1758 | 66787 | 7.54 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0032153;GO:0051286;GO:0005829;GO:0005634 | cell division site;cell tip;cytosol;nucleus | GO:0004197;GO:0004843;GO:0036459 | cysteine-type endopeptidase activity;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0006897;GO:0035871;GO:0071108;GO:0016579 | endocytosis;protein K11-linked deubiquitination;protein K48-linked deubiquitination;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC1703.12ORubiquitin C-terminal hydrolase Ubp9ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC1703.12 OR ubiquitin C-terminal hydrolase Ubp9 AND Schizosaccharomyces pombe 972h- |
|
SPBC1709.07 | SPBC1709.07.1 | 3 | 3 | 1 | 434 | 73 | forward | protein coding | No | 1524 | SPBC1709.07 | 3-keto sterol reductase Erg27 (predicted) | 3-keto sterol reductase Erg27 (predicted) | 2540195 | O74732 | II | Spom972h_chrII:1,110,817..1,112,435(+) | Spom972h_chrII:1110890..1112001(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 151 | OG6_106304 | 0 | 338 | 1017 | 38724 | 8.11 | 0 | | | | | | | | | GO:0005789;GO:0005811 | endoplasmic reticulum membrane;lipid droplet | GO:0000253 | 3-keto sterol reductase activity | GO:0006696 | ergosterol biosynthetic process | 1.1.1.270 (3-beta-hydroxysteroid 3-dehydrogenase) | 1.1.1.270 (3-beta-hydroxysteroid 3-dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC1709.07OR3-keto sterol reductase Erg27 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC1709.07 OR 3-keto sterol reductase Erg27 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC1709.14 | SPBC1709.14.1 | 5 | 5 | 1 | 150 | 312 | forward | protein coding | No | 1464 | SPBC1709.14 | peptide N-glycanase | peptide N-glycanase | 2539952 | O74739 | II | Spom972h_chrII:1,126,316..1,127,990(+) | Spom972h_chrII:1126628..1127840(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 157 | OG6_103952 | 0 | 333 | 1002 | 39240 | 5.66 | 0 | | | | | | | | | GO:0005829;GO:0005635;GO:0005634 | cytosol;nuclear envelope;nucleus | GO:0046872;GO:0051787;GO:0000224 | metal ion binding;misfolded protein binding;peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase activity | GO:0071712;GO:0006516;GO:0006058;GO:0006517;GO:0035977;GO:0006515 | ER-associated misfolded protein catabolic process;glycoprotein catabolic process;mannoprotein catabolic process;protein deglycosylation;protein deglycosylation involved in glycoprotein catabolic process;protein quality control for misfolded or incompletely synthesized proteins | 3.5.1.52 (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase) | 3.5.1.52 (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC1709.14ORpeptide N-glycanaseANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC1709.14 OR peptide N-glycanase AND Schizosaccharomyces pombe 972h- |
|
SPBC1711.12 | SPBC1711.12.1 | 1 | 1 | 1 | 57 | 82 | forward | protein coding | No | 2191 | SPBC1711.12 | serine-type peptidase activity | serine-type peptidase activity | 2539662 | Q9P778 | II | Spom972h_chrII:2,157,543..2,159,733(+) | Spom972h_chrII:2157625..2159676(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 198 | OG6_104931 | 0 | 683 | 2052 | 77765 | 6.36 | 0 | NN: MHSLFKQLVFFLVMTLTAAD, HMM: MHSLFKQLVFFLVMTLTAAD | NN Sum: 4, NN D: .82, HMM Prob: .97 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005829;GO:0005634 | cytosol;nucleus | | | GO:0008150 | biological_process | 3.4.14.- (Dipeptidyl-peptidases and tripeptidyl-peptidases.) | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC1711.12ORserine-type peptidase activityANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC1711.12 OR serine-type peptidase activity AND Schizosaccharomyces pombe 972h- |
|
SPBC17D11.01 | SPBC17D11.01.1 | 3 | 3 | 1 | 319 | 110 | forward | protein coding | No | 1692 | SPBC17D11.01 | NEDD8 protease Nep1 | NEDD8 protease Nep1 | 2539808 | O42980 | II | Spom972h_chrII:3,304,727..3,306,572(+) | Spom972h_chrII:3304837..3306253(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 170 | OG6_103852 | 1 | 420 | 1263 | 47257 | 6.12 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0008180;GO:0005737 | COP9 signalosome;cytoplasm | GO:0019784;GO:0005515 | NEDD8-specific protease activity;protein binding | GO:0000338 | protein deneddylation | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC17D11.01ORNEDD8 protease Nep1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC17D11.01 OR NEDD8 protease Nep1 AND Schizosaccharomyces pombe 972h- |
|
SPBC18A7.01 | SPBC18A7.01.1 | 1 | 1 | 1 | 161 | 63 | forward | protein coding | No | 1580 | SPBC18A7.01 | X-Pro dipeptidase (predicted) | X-Pro dipeptidase (predicted) | 2540809 | Q9UUD8 | II | Spom972h_chrII:2,729,195..2,730,774(+) | Spom972h_chrII:2729258..2730613(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 242 | OG6_100598 | 1 | 451 | 1356 | 50593 | 5.71 | 1 | | | | | GO:0016787;GO:0046872 | hydrolase activity;metal ion binding | | | GO:0005794;GO:0005783 | Golgi apparatus;endoplasmic reticulum | GO:0016805 | dipeptidase activity | GO:0008150 | biological_process | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC18A7.01ORX-Pro dipeptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC18A7.01 OR X-Pro dipeptidase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC18E5.12c | SPBC18E5.12c.1 | 1 | 1 | 1 | 81 | 3 | reverse | protein coding | No | 1593 | SPBC18E5.12c | mitochondrial processing peptidase(MPP) complex alpha subunit Mas2 (predicted) | mitochondrial processing peptidase(MPP) complex alpha subunit Mas2 (predicted) | 2540713 | O94745 | II | Spom972h_chrII:2,096,447..2,098,039(-) | Spom972h_chrII:2096528..2098036(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 155 | OG6_102381 | 0 | 502 | 1509 | 55577 | 7.14 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005743;GO:0017087;GO:0005739 | mitochondrial inner membrane;mitochondrial processing peptidase complex;mitochondrion | GO:0004175;GO:0004222 | endopeptidase activity;metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC18E5.12cORmitochondrial processing peptidase(MPP) complex alpha subunit Mas2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC18E5.12c OR mitochondrial processing peptidase(MPP) complex alpha subunit Mas2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC18H10.08c | SPBC18H10.08c.1 | 4 | 4 | 1 | 358 | 254 | reverse | protein coding | No | 2394 | SPBC18H10.08c | ubiquitin C-terminal hydrolase Ubp4 | ubiquitin C-terminal hydrolase Ubp4 | 2540837 | O60139 | II | Spom972h_chrII:1,783,861..1,786,542(-) | Spom972h_chrII:1784219..1786248(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 142 | OG6_101021 | 0 | 593 | 1782 | 67746 | 8.16 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0032153;GO:0005737;GO:0005768 | cell division site;cytoplasm;endosome | GO:0005515;GO:0004843;GO:0036459 | protein binding;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0035871;GO:0071108;GO:0016579 | protein K11-linked deubiquitination;protein K48-linked deubiquitination;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC18H10.08cORubiquitin C-terminal hydrolase Ubp4ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC18H10.08c OR ubiquitin C-terminal hydrolase Ubp4 AND Schizosaccharomyces pombe 972h- |
|
SPBC1921.05 | SPBC1921.05.1 | 1 | 1 | 1 | 386 | 1830 | forward | protein coding | No | 4865 | SPBC1921.05 | aminopeptidase Ape2 (predicted) | aminopeptidase Ape2 (predicted) | 2540648 | Q9USX1 | II | Spom972h_chrII:2,411,677..2,416,541(+) | Spom972h_chrII:2413507..2416155(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 307 | OG6_100948 | 0 | 882 | 2649 | 99445 | 5.61 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | GO:0061957;GO:0005737;GO:0005829;GO:0000328;GO:0005771 | NVT complex;cytoplasm;cytosol;fungal-type vacuole lumen;multivesicular body | GO:0070006;GO:0042277;GO:0005515;GO:0008270 | metalloaminopeptidase activity;peptide binding;protein binding;zinc ion binding | GO:0043171;GO:0120113;GO:0016485;GO:0006508 | peptide catabolic process;protein localization by the NVT pathway;protein processing;proteolysis | 3.4.11.- (Aminopeptidases.) | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC1921.05ORaminopeptidase Ape2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC1921.05 OR aminopeptidase Ape2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC19C2.04c | SPBC19C2.04c.1 | 1 | 1 | 1 | 172 | 1076 | reverse | protein coding | No | 2301 | SPBC19C2.04c | ubiquitin C-terminal hydrolase Ubp11 | ubiquitin C-terminal hydrolase Ubp11 | 2540714 | Q9UUD6 | II | Spom972h_chrII:1,676,352..1,678,652(-) | Spom972h_chrII:1676524..1677576(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 167 | OG6_104100 | 0 | 350 | 1053 | 39168 | 8.78 | 1 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016578;GO:0016579;GO:0006511 | histone deubiquitination;protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005739 | mitochondrion | GO:0004197;GO:0004843 | cysteine-type endopeptidase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC19C2.04cORubiquitin C-terminal hydrolase Ubp11ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC19C2.04c OR ubiquitin C-terminal hydrolase Ubp11 AND Schizosaccharomyces pombe 972h- |
|
SPBC19G7.04 | SPBC19G7.04.1 | 3 | 3 | 1 | 216 | 451 | forward | protein coding | No | 1756 | SPBC19G7.04 | HMG box protein | HMG box protein | 2540683 | O42953 | II | Spom972h_chrII:2,349,142..2,350,982(+) | Spom972h_chrII:2349593..2350766(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 102 | OG6_105344 | 0 | 362 | 1089 | 41627 | 9.98 | 0 | | | | | | | | | GO:0005634 | nucleus | GO:0003677;GO:0008233 | DNA binding;peptidase activity | GO:0036297 | interstrand cross-link repair | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC19G7.04ORHMG box proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC19G7.04 OR HMG box protein AND Schizosaccharomyces pombe 972h- |
|
SPBC19G7.09 | SPBC19G7.09.1 | 1 | 1 | 1 | 370 | 38 | forward | protein coding | No | 2115 | SPBC19G7.09 | SUMO deconjugating enzyme Ulp1 | SUMO deconjugating enzyme Ulp1 | 2540734 | O42957 | II | Spom972h_chrII:2,367,079..2,369,193(+) | Spom972h_chrII:2367117..2368823(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 212 | OG6_101235 | 0 | 568 | 1707 | 64940 | 9.72 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005829;GO:0005635;GO:0034399;GO:0005634 | cytoplasm;cytosol;nuclear envelope;nuclear periphery;nucleus | GO:0070139;GO:0070140 | SUMO-specific endopeptidase activity;SUMO-specific isopeptidase activity | GO:0030466;GO:0016926;GO:0016485 | chromatin silencing at silent mating-type cassette;protein desumoylation;protein processing | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC19G7.09ORSUMO deconjugating enzyme Ulp1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC19G7.09 OR SUMO deconjugating enzyme Ulp1 AND Schizosaccharomyces pombe 972h- |
|
SPBC23E6.05 | SPBC23E6.05.1 | 3 | 3 | 1 | 142 | 74 | forward | protein coding | No | 1470 | SPBC23E6.05 | ribosomal export complex protein Arx1, peptidase family (predicted) | ribosomal export complex protein Arx1, peptidase family (predicted) | 2540457 | O60180 | II | Spom972h_chrII:3,849,937..3,851,579(+) | Spom972h_chrII:3850011..3851437(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 15 | OG6_191818 | 0 | 417 | 1254 | 45672 | 6.09 | 0 | | | | | GO:0046872 | metal ion binding | | | GO:0005737;GO:0005829;GO:0005635;GO:0005730;GO:0005634 | cytoplasm;cytosol;nuclear envelope;nucleolus;nucleus | GO:0008237;GO:0003676 | metallopeptidase activity;nucleic acid binding | GO:0042273;GO:0000055 | ribosomal large subunit biogenesis;ribosomal large subunit export from nucleus | 3.-.-.- (Hydrolases.) | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC23E6.05ORribosomal export complex protein Arx1, peptidase family (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC23E6.05 OR ribosomal export complex protein Arx1, peptidase family (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC23G7.12c | SPBC23G7.12c.1 | 2 | 2 | 1 | 86 | 34 | reverse | protein coding | No | 1332 | SPBC23G7.12c | 19S proteasome regulatory subunit Rpt6 (predicted) | 19S proteasome regulatory subunit Rpt6 (predicted) | 2540487 | P41836 | II | Spom972h_chrII:2,121,444..2,122,817(-) | Spom972h_chrII:2121530..2122783(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 153 | OG6_101513 | 0 | 403 | 1212 | 45068 | 8.60 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005829;GO:0031597;GO:0005635;GO:0031595;GO:0005634;GO:0008540 | cytosol;cytosolic proteasome complex;nuclear envelope;nuclear proteasome complex;nucleus;proteasome regulatory particle, base subcomplex | GO:0005524;GO:0017025;GO:0036402 | ATP binding;TBP-class protein binding;proteasome-activating ATPase activity | GO:0045899;GO:0045842;GO:0043161 | positive regulation of RNA polymerase II transcriptional preinitiation complex assembly;positive regulation of mitotic metaphase/anaphase transition;proteasome-mediated ubiquitin-dependent protein catabolic process | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC23G7.12cOR19S proteasome regulatory subunit Rpt6 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC23G7.12c OR 19S proteasome regulatory subunit Rpt6 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC2D10.07c | SPBC2D10.07c.1 | 3 | 3 | 1 | 170 | | reverse | protein coding | No | 644 | SPBC2D10.07c | mitochondrial inner membrane peptidase complex catalytic subunit (predicted) | mitochondrial inner membrane peptidase complex catalytic subunit (predicted) | 2540493 | O74800 | II | Spom972h_chrII:2,978,736..2,979,469(-) | Spom972h_chrII:2978906..2979469(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 178 | OG6_100609 | 0 | 157 | 474 | 17269 | 8.74 | 0 | NN: MAGMFRIPIAVVQIAAF, HMM: MAGMFRIPIAVVQIAAFVHQI | NN Sum: 2, NN D: .53, HMM Prob: .3 | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0042720;GO:0005739 | mitochondrial inner membrane peptidase complex;mitochondrion | GO:0004222;GO:0008236 | metalloendopeptidase activity;serine-type peptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.21.- (Serine endopeptidases.) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC2D10.07cORmitochondrial inner membrane peptidase complex catalytic subunit (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC2D10.07c OR mitochondrial inner membrane peptidase complex catalytic subunit (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC2D10.09 | SPBC2D10.09.1 | 1 | 1 | 1 | 89 | 271 | forward | protein coding | No | 1650 | SPBC2D10.09 | 3-hydroxyisobutyryl-CoA hydrolase snr1 | 3-hydroxyisobutyryl-CoA hydrolase snr1 | 2540394 | O74802 | II | Spom972h_chrII:2,980,791..2,982,440(+) | Spom972h_chrII:2981062..2982351(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 169 | OG6_102025 | 0 | 429 | 1290 | 47933 | 9.77 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | GO:0006574 | valine catabolic process | GO:0005739 | mitochondrion | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | GO:0006635 | fatty acid beta-oxidation | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC2D10.09OR3-hydroxyisobutyryl-CoA hydrolase snr1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC2D10.09 OR 3-hydroxyisobutyryl-CoA hydrolase snr1 AND Schizosaccharomyces pombe 972h- |
|
SPBC2D10.20 | SPBC2D10.20.1 | 6 | 6 | 1 | 2713 | 344 | forward | protein coding | No | 3711 | SPBC2D10.20 | ubiquitin conjugating enzyme Ubc1 (predicted) | ubiquitin conjugating enzyme Ubc1 (predicted) | 2540277 | O74810 | II | Spom972h_chrII:3,004,091..3,008,103(+) | Spom972h_chrII:3004435..3005390(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 162 | OG6_103192 | 0 | 217 | 654 | 24506 | 4.55 | 0 | | | | | GO:0005524 | ATP binding | | | GO:0005829;GO:0005634 | cytosol;nucleus | GO:0005515;GO:0061631 | protein binding;ubiquitin conjugating enzyme activity | GO:0070647;GO:0030433 | protein modification by small protein conjugation or removal;ubiquitin-dependent ERAD pathway | 2.3.2.23 (E2 ubiquitin-conjugating enzyme) | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC2D10.20ORubiquitin conjugating enzyme Ubc1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC2D10.20 OR ubiquitin conjugating enzyme Ubc1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC32H8.02c | SPBC32H8.02c.1 | 1 | 1 | 1 | 856 | 1296 | reverse | protein coding | No | 3400 | SPBC32H8.02c | NEDD8 protease Nep2 | NEDD8 protease Nep2 | 2540263 | O13612 | II | Spom972h_chrII:1,451,331..1,454,730(-) | Spom972h_chrII:1452187..1453434(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 170 | OG6_103852 | 1 | 415 | 1248 | 46432 | 8.98 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005634 | cytoplasm;nucleus | GO:0019784 | NEDD8-specific protease activity | GO:0000338 | protein deneddylation | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC32H8.02cORNEDD8 protease Nep2ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC32H8.02c OR NEDD8 protease Nep2 AND Schizosaccharomyces pombe 972h- |
|
SPBC32H8.03 | SPBC32H8.03.1 | 1 | 1 | 1 | 286 | 107 | forward | protein coding | No | 1293 | SPBC32H8.03 | esterase/lipase (predicted) | esterase/lipase (predicted) | 2540264 | P54069 | II | Spom972h_chrII:1,457,557..1,458,849(+) | Spom972h_chrII:1457664..1458563(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 181 | OG6_101827 | 0 | 299 | 900 | 33132 | 8.43 | 1 | | | GO:0016021 | integral component of membrane | | | | | GO:0005783 | endoplasmic reticulum | GO:0016788 | hydrolase activity, acting on ester bonds | GO:0008150 | biological_process | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC32H8.03OResterase/lipase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC32H8.03 OR esterase/lipase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC336.13c | SPBC336.13c.1 | 3 | 3 | 1 | 186 | 267 | reverse | protein coding | No | 996 | SPBC336.13c | mitochondrial inner membrane peptidase complex catalytic subunit 2 (predicted) | mitochondrial inner membrane peptidase complex catalytic subunit 2 (predicted) | 2540235 | Q9UST2 | II | Spom972h_chrII:2,764,129..2,765,263(-) | Spom972h_chrII:2764315..2764996(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 146 | OG6_103471 | 0 | 180 | 543 | 20545 | 10.66 | 1 | | | GO:0016021 | integral component of membrane | | | GO:0006465 | signal peptide processing | GO:0042720;GO:0005739 | mitochondrial inner membrane peptidase complex;mitochondrion | GO:0004222;GO:0008236 | metalloendopeptidase activity;serine-type peptidase activity | GO:0033108;GO:0006627 | mitochondrial respiratory chain complex assembly;protein processing involved in protein targeting to mitochondrion | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC336.13cORmitochondrial inner membrane peptidase complex catalytic subunit 2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC336.13c OR mitochondrial inner membrane peptidase complex catalytic subunit 2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC337.07c | SPBC337.07c.1 | 5 | 5 | 1 | 185 | 183 | reverse | protein coding | No | 1862 | SPBC337.07c | carboxypeptidase Ecm14 (predicted) | carboxypeptidase Ecm14 (predicted) | 2541067 | O74818 | II | Spom972h_chrII:1,042,110..1,044,142(-) | Spom972h_chrII:1042295..1043959(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 359 | OG6_100142 | 0 | 497 | 1494 | 57485 | 4.65 | 1 | HMM: MAYNKSLKSLVFILLASQIVFVLFLCYGK, NN: MAYNKSLKSLVFILLASQIVFVLFLCYGK | NN Sum: 3, NN D: .62, HMM Prob: .18 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005576;GO:0005615 | extracellular region;extracellular space | GO:0004181 | metallocarboxypeptidase activity | GO:0009272;GO:0006508 | fungal-type cell wall biogenesis;proteolysis | 3.4.17.- (Metallocarboxypeptidases.) | 3.4.17.- (Metallocarboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC337.07cORcarboxypeptidase Ecm14 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC337.07c OR carboxypeptidase Ecm14 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC354.09c | SPBC354.09c.1 | 1 | 1 | 1 | 216 | 725 | reverse | protein coding | No | 3326 | SPBC354.09c | Tre1 family protein, involved in vacuolar protein degradation (predicted) | Tre1 family protein, involved in vacuolar protein degradation (predicted) | 2540952 | O43023 | II | Spom972h_chrII:565,094..568,419(-) | Spom972h_chrII:565310..567694(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 425 | OG6_100685 | 0 | 794 | 2385 | 88965 | 4.39 | 1 | | | | | | | | | GO:0071627 | integral component of fungal-type vacuolar membrane | GO:0003674 | molecular_function | GO:0043328 | protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC354.09cORTre1 family protein, involved in vacuolar protein degradation (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC354.09c OR Tre1 family protein, involved in vacuolar protein degradation (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC365.08c | SPBC365.08c.1 | 3 | 3 | 1 | 327 | 71 | reverse | protein coding | No | 1073 | SPBC365.08c | Der1-like (degradation in the ER) family (predicted) | Der1-like (degradation in the ER) family (predicted) | 2541072 | Q9Y7Y0 | II | Spom972h_chrII:2,509,332..2,510,505(-) | Spom972h_chrII:2509659..2510434(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 134 | OG6_104075 | 0 | 224 | 675 | 25112 | 10.12 | 4 | | | GO:0016021 | integral component of membrane | | | | | GO:0000836;GO:0005783 | Hrd1p ubiquitin ligase complex;endoplasmic reticulum | GO:0003674 | molecular_function | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC365.08cORDer1-like (degradation in the ER) family (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC365.08c OR Der1-like (degradation in the ER) family (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC3E7.10 | SPBC3E7.10.1 | 4 | 4 | 1 | 110 | 201 | forward | protein coding | No | 1451 | SPBC3E7.10 | methionine aminopeptidase Fma1 (predicted) | methionine aminopeptidase Fma1 (predicted) | 2540928 | O59730 | II | Spom972h_chrII:2,678,672..2,680,283(+) | Spom972h_chrII:2678873..2680173(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 250 | OG6_100342 | 0 | 379 | 1140 | 42138 | 7.62 | 0 | | | | | GO:0004177;GO:0046872;GO:0008235 | aminopeptidase activity;metal ion binding;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005829;GO:0005730;GO:0005634 | cytosol;nucleolus;nucleus | GO:0070006 | metalloaminopeptidase activity | GO:0035551 | protein initiator methionine removal involved in protein maturation | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC3E7.10ORmethionine aminopeptidase Fma1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC3E7.10 OR methionine aminopeptidase Fma1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC4.07c | SPBC4.07c.1 | 2 | 2 | 1 | 120 | 52 | reverse | protein coding | No | 1519 | SPBC4.07c | 19S proteasome regulatory subunit Rpt2 | 19S proteasome regulatory subunit Rpt2 | 2540939 | P36612 | II | Spom972h_chrII:1,197,778..1,199,431(-) | Spom972h_chrII:1197898..1199379(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 145 | OG6_101477 | 0 | 448 | 1347 | 50059 | 5.44 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005829;GO:0000790;GO:0005634;GO:0005838;GO:0008540 | cytosol;nuclear chromatin;nucleus;proteasome regulatory particle;proteasome regulatory particle, base subcomplex | GO:0017025;GO:0036402;GO:0005515 | TBP-class protein binding;proteasome-activating ATPase activity;protein binding | GO:0045842;GO:0010498 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC4.07cOR19S proteasome regulatory subunit Rpt2ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC4.07c OR 19S proteasome regulatory subunit Rpt2 AND Schizosaccharomyces pombe 972h- |
|
SPBC409.06 | SPBC409.06.1 | 2 | 2 | 1 | 249 | 98 | forward | protein coding | No | 1250 | SPBC409.06 | ubiquitin C-terminal hydrolase Uch2 | ubiquitin C-terminal hydrolase Uch2 | 2540956 | Q9UUB6 | II | Spom972h_chrII:1,142,122..1,143,522(+) | Spom972h_chrII:1142220..1143273(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 155 | OG6_102753 | 0 | 300 | 903 | 34195 | 4.63 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0034399;GO:0031595;GO:0005634 | cytoplasm;nuclear periphery;nuclear proteasome complex;nucleus | GO:0019784;GO:0004843 | NEDD8-specific protease activity;thiol-dependent ubiquitin-specific protease activity | GO:0071629;GO:0000338;GO:0016579 | cytoplasm protein quality control by the ubiquitin-proteasome system;protein deneddylation;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC409.06ORubiquitin C-terminal hydrolase Uch2ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC409.06 OR ubiquitin C-terminal hydrolase Uch2 AND Schizosaccharomyces pombe 972h- |
|
SPBC4C3.07 | SPBC4C3.07.1 | 1 | 1 | 1 | 248 | 163 | reverse | protein coding | No | 1320 | SPBC4C3.07 | translation initiation factor eIF3f | translation initiation factor eIF3f | 2540868 | O43060 | II | Spom972h_chrII:3,122,650..3,123,969(-) | Spom972h_chrII:3122898..3123806(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 147 | OG6_103242 | 0 | 302 | 909 | 33250 | 6.34 | 0 | | | GO:0033290 | eukaryotic 48S preinitiation complex | GO:0005515 | protein binding | | | GO:0005737;GO:0005829;GO:0016282;GO:0005852;GO:0071540;GO:0071541 | cytoplasm;cytosol;eukaryotic 43S preinitiation complex;eukaryotic translation initiation factor 3 complex;eukaryotic translation initiation factor 3 complex, eIF3e;eukaryotic translation initiation factor 3 complex, eIF3m | GO:0004843;GO:0003743;GO:0031369 | thiol-dependent ubiquitin-specific protease activity;translation initiation factor activity;translation initiation factor binding | GO:0002183;GO:0001732;GO:0070647;GO:0006413 | cytoplasmic translational initiation;formation of cytoplasmic translation initiation complex;protein modification by small protein conjugation or removal;translational initiation | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC4C3.07ORtranslation initiation factor eIF3fANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC4C3.07 OR translation initiation factor eIF3f AND Schizosaccharomyces pombe 972h- |
|
SPBC4C3.10c | SPBC4C3.10c.1 | 4 | 4 | 1 | 256 | 617 | forward | protein coding | No | 1554 | SPBC4C3.10c | 20S proteasome complex subunit beta 1 Pre3 (predicted) | 20S proteasome complex subunit beta 1 Pre3 (predicted) | 2540878 | O43063 | II | Spom972h_chrII:3,117,052..3,118,883(+) | Spom972h_chrII:3117669..3118627(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 147 | OG6_101390 | 0 | 226 | 681 | 24563 | 6.51 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005829;GO:0005634;GO:0005839;GO:0019774 | cytoplasm;cytosol;nucleus;proteasome core complex;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC4C3.10cOR20S proteasome complex subunit beta 1 Pre3 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC4C3.10c OR 20S proteasome complex subunit beta 1 Pre3 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC4F6.17c | SPBC4F6.17c.1 | 1 | 1 | 1 | 116 | 84 | reverse | protein coding | No | 2612 | SPBC4F6.17c | mitochondrial heatshock protein Hsp78 (predicted) | mitochondrial heatshock protein Hsp78 (predicted) | 2540898 | O74402 | II | Spom972h_chrII:2,723,119..2,725,730(-) | Spom972h_chrII:2723235..2725646(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 326 | OG6_100223 | 1 | 803 | 2412 | 90153 | 7.67 | 0 | | | | | GO:0005524 | ATP binding | | | GO:0005759 | mitochondrial matrix | GO:0005524;GO:0016887;GO:0051082 | ATP binding;ATPase activity;unfolded protein binding | GO:0042026;GO:0050821;GO:0043335 | protein refolding;protein stabilization;protein unfolding | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC4F6.17cORmitochondrial heatshock protein Hsp78 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC4F6.17c OR mitochondrial heatshock protein Hsp78 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC543.09 | SPBC543.09.1 | 1 | 1 | 1 | 260 | 479 | forward | protein coding | No | 3061 | SPBC543.09 | mitochondrial m-AAA protease Yta12 (predicted) | mitochondrial m-AAA protease Yta12 (predicted) | 2541079 | Q9HGM3 | II | Spom972h_chrII:4,315,809..4,318,869(+) | Spom972h_chrII:4316288..4318609(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 172 | OG6_100384 | 0 | 773 | 2322 | 85367 | 9.90 | 2 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0005524;GO:0004222;GO:0008270 | ATP binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005745;GO:0005743;GO:0005739 | m-AAA complex;mitochondrial inner membrane;mitochondrion | GO:0005524;GO:0016887 | ATP binding;ATPase activity | GO:0042407;GO:0008053;GO:0034982;GO:0006465 | cristae formation;mitochondrial fusion;mitochondrial protein processing;signal peptide processing | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC543.09ORmitochondrial m-AAA protease Yta12 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC543.09 OR mitochondrial m-AAA protease Yta12 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC577.07 | SPBC577.07.1 | 3 | 3 | 1 | 142 | 56 | forward | protein coding | No | 1707 | SPBC577.07 | ubiquitin C-terminal hydrolase Ubp10 (predicted) | ubiquitin C-terminal hydrolase Ubp10 (predicted) | 2540864 | Q9USR2 | II | Spom972h_chrII:764,540..766,395(+) | Spom972h_chrII:764596..766253(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 150 | OG6_102786 | 0 | 502 | 1509 | 58884 | 7.24 | 0 | | | GO:0005681 | spliceosomal complex | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0000245 | protein deubiquitination;spliceosomal complex assembly | GO:0005634 | nucleus | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0045292 | mRNA cis splicing, via spliceosome | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC577.07ORubiquitin C-terminal hydrolase Ubp10 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC577.07 OR ubiquitin C-terminal hydrolase Ubp10 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC577.10 | SPBC577.10.1 | 1 | 1 | 1 | 467 | 41 | forward | protein coding | No | 1297 | SPBC577.10 | 20S proteasome complex subunit beta 7, Pre4 (predicted) | 20S proteasome complex subunit beta 7, Pre4 (predicted) | 2540875 | Q9USQ9 | II | Spom972h_chrII:769,641..770,937(+) | Spom972h_chrII:769682..770470(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 154 | OG6_101718 | 0 | 262 | 789 | 29219 | 4.79 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005829;GO:0005634;GO:0005839;GO:0019774 | cytoplasm;cytosol;nucleus;proteasome core complex;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC577.10OR20S proteasome complex subunit beta 7, Pre4 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC577.10 OR 20S proteasome complex subunit beta 7, Pre4 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC646.16 | SPBC646.16.1 | 1 | 1 | 1 | 245 | 44 | forward | protein coding | No | 1024 | SPBC646.16 | 20S proteasome complex subunit alpha 1 (predicted) | 20S proteasome complex subunit alpha 1 (predicted) | 2541139 | O94517 | II | Spom972h_chrII:957,614..958,637(+) | Spom972h_chrII:957658..958392(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 158 | OG6_102240 | 0 | 244 | 735 | 26539 | 7.29 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829;GO:0005634;GO:0005839;GO:0019773 | cytoplasm;cytosol;nucleus;proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC646.16OR20S proteasome complex subunit alpha 1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC646.16 OR 20S proteasome complex subunit alpha 1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC6B1.06c | SPBC6B1.06c.1 | 2 | 2 | 1 | 284 | 90 | reverse | protein coding | No | 2702 | SPBC6B1.06c | ubiquitin C-terminal hydrolase Ubp14 | ubiquitin C-terminal hydrolase Ubp14 | 2541157 | Q11119 | II | Spom972h_chrII:2,637,329..2,640,099(-) | Spom972h_chrII:2637613..2640009(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 156 | OG6_101380 | 0 | 775 | 2328 | 86782 | 4.53 | 0 | | | | | GO:0005515;GO:0004843;GO:0036459;GO:0008270 | protein binding;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | GO:0005730;GO:0005654;GO:0005634 | nucleolus;nucleoplasm;nucleus | GO:1990380;GO:0004197;GO:0004843 | Lys48-specific deubiquitinase activity;cysteine-type endopeptidase activity;thiol-dependent ubiquitin-specific protease activity | GO:0043161;GO:0071108;GO:0016579 | proteasome-mediated ubiquitin-dependent protein catabolic process;protein K48-linked deubiquitination;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC6B1.06cORubiquitin C-terminal hydrolase Ubp14ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC6B1.06c OR ubiquitin C-terminal hydrolase Ubp14 AND Schizosaccharomyces pombe 972h- |
|
SPBC713.02c | SPBC713.02c.1 | 3 | 3 | 1 | 269 | 232 | reverse | protein coding | No | 3891 | SPBC713.02c | ubiquitin C-terminal hydrolase Ubp15 | ubiquitin C-terminal hydrolase Ubp15 | 2541131 | Q9UTT1 | II | Spom972h_chrII:866,271..870,314(-) | Spom972h_chrII:866540..870082(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 221 | OG6_101317 | 1 | 1129 | 3390 | 130831 | 5.18 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829;GO:0005730;GO:0005634 | cytoplasm;cytosol;nucleolus;nucleus | GO:0004197;GO:0004175;GO:0004843;GO:0036459;GO:0008134;GO:0101005 | cysteine-type endopeptidase activity;endopeptidase activity;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;transcription factor binding;ubiquitinyl hydrolase activity | GO:1904332;GO:0035871;GO:0070536;GO:0016579;GO:0051090;GO:0031647 | negative regulation of error-prone translesion synthesis;protein K11-linked deubiquitination;protein K63-linked deubiquitination;protein deubiquitination;regulation of DNA-binding transcription factor activity;regulation of protein stability | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC713.02cORubiquitin C-terminal hydrolase Ubp15ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC713.02c OR ubiquitin C-terminal hydrolase Ubp15 AND Schizosaccharomyces pombe 972h- |
|
SPBC887.22 | SPBC887.22.1 | 3 | 3 | 1 | 687 | | forward | protein coding | No | 924 | SPBC887.22 | signal peptidase complex subunit Spc1 (predicted) | signal peptidase complex subunit Spc1 (predicted) | 14217705 | G2TRR4 | II | Spom972h_chrII:3,537,089..3,538,112(+) | Spom972h_chrII:3537089..3537425(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 122 | OG6_103297 | 0 | 78 | 237 | 8989 | 8.87 | 2 | | | GO:0016021;GO:0031090;GO:0005787 | integral component of membrane;organelle membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0030176;GO:0005787 | integral component of endoplasmic reticulum membrane;signal peptidase complex | | | GO:0045047;GO:0006465 | protein targeting to ER;signal peptide processing | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC887.22ORsignal peptidase complex subunit Spc1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC887.22 OR signal peptidase complex subunit Spc1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBC947.09 | SPBC947.09.1 | 1 | 1 | 1 | 206 | 765 | reverse | protein coding | No | 1757 | SPBC947.09 | ThiJ domain protein | ThiJ domain protein | 2541295 | O43084 | II | Spom972h_chrII:656,117..657,873(-) | Spom972h_chrII:656323..657108(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 278 | OG6_105123 | 3 | 261 | 786 | 28533 | 4.78 | 0 | | | | | | | | | GO:0005575 | cellular_component | GO:0003824;GO:0019172 | catalytic activity;glyoxalase III activity | | | 4.2.1.130 (D-lactate dehydratase) | 4.2.1.130 (D-lactate dehydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBC947.09ORThiJ domain proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBC947.09 OR ThiJ domain protein AND Schizosaccharomyces pombe 972h- |
|
SPBP23A10.15c | SPBP23A10.15c.1 | 1 | 1 | 1 | 628 | 100 | reverse | protein coding | No | 2102 | SPBP23A10.15c | mitochondrial processing peptidase (MPP) complex beta subunit Mas1 (predicted) | mitochondrial processing peptidase (MPP) complex beta subunit Mas1 (predicted) | 2541300 | Q9P7X1 | II | Spom972h_chrII:2,032,842..2,034,943(-) | Spom972h_chrII:2033470..2034843(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 157 | OG6_100777 | 0 | 457 | 1374 | 50736 | 6.81 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005743;GO:0017087;GO:0005739 | mitochondrial inner membrane;mitochondrial processing peptidase complex;mitochondrion | GO:0004175;GO:0004222 | endopeptidase activity;metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBP23A10.15cORmitochondrial processing peptidase (MPP) complex beta subunit Mas1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBP23A10.15c OR mitochondrial processing peptidase (MPP) complex beta subunit Mas1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPBP4H10.10 | SPBP4H10.10.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1179 | SPBP4H10.10 | rhomboid family protease | rhomboid family protease | 2541325 | Q9P7D8 | II | Spom972h_chrII:2,890,645..2,891,823(+) | Spom972h_chrII:2890645..2891823(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 31 | OG6_124366 | 0 | 392 | 1179 | 44252 | 10.17 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0005743;GO:0005739 | mitochondrial inner membrane;mitochondrion | GO:0004252 | serine-type endopeptidase activity | GO:0008150;GO:0010821 | biological_process;regulation of mitochondrion organization | 3.4.21.- (Serine endopeptidases.) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBP4H10.10ORrhomboid family proteaseANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBP4H10.10 OR rhomboid family protease AND Schizosaccharomyces pombe 972h- |
|
SPBP8B7.19 | SPBP8B7.19.1 | 1 | 1 | 1 | 104 | 143 | forward | protein coding | No | 3307 | SPBP8B7.19 | FACT complex subunit Spt16 | FACT complex subunit Spt16 | 2541355 | O94267 | II | Spom972h_chrII:3,671,316..3,674,622(+) | Spom972h_chrII:3671459..3674518(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 151 | OG6_102309 | 0 | 1019 | 3060 | 116449 | 4.90 | 0 | | | | | | | | | GO:0035101;GO:0000790;GO:0005634 | FACT complex;nuclear chromatin;nucleus | GO:0042393;GO:0031491;GO:0005515 | histone binding;nucleosome binding;protein binding | GO:0034724;GO:0006338;GO:0043486;GO:0006334;GO:0032968;GO:0006368 | DNA replication-independent nucleosome organization;chromatin remodeling;histone exchange;nucleosome assembly;positive regulation of transcription elongation from RNA polymerase II promoter;transcription elongation from RNA polymerase II promoter | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBP8B7.19ORFACT complex subunit Spt16ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBP8B7.19 OR FACT complex subunit Spt16 AND Schizosaccharomyces pombe 972h- |
|
SPBP8B7.21 | SPBP8B7.21.1 | 2 | 2 | 1 | 372 | 817 | forward | protein coding | No | 2728 | SPBP8B7.21 | ubiquitin C-terminal hydrolase Ubp3 | ubiquitin C-terminal hydrolase Ubp3 | 2541378 | O94269 | II | Spom972h_chrII:3,676,896..3,679,661(+) | Spom972h_chrII:3677713..3679289(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 169 | OG6_103260 | 0 | 512 | 1539 | 58080 | 7.03 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737;GO:0010494;GO:0005829;GO:0005634 | cytoplasm;cytoplasmic stress granule;cytosol;nucleus | GO:0004197;GO:1905538;GO:0004843 | cysteine-type endopeptidase activity;polysome binding;thiol-dependent ubiquitin-specific protease activity | GO:0071629;GO:0016579;GO:0060628 | cytoplasm protein quality control by the ubiquitin-proteasome system;protein deubiquitination;regulation of ER to Golgi vesicle-mediated transport | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBP8B7.21ORubiquitin C-terminal hydrolase Ubp3ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBP8B7.21 OR ubiquitin C-terminal hydrolase Ubp3 AND Schizosaccharomyces pombe 972h- |
|
SPBP8B7.24c | SPBP8B7.24c.1 | 3 | 3 | 1 | 372 | 194 | reverse | protein coding | No | 932 | SPBP8B7.24c | autophagy associated protein Atg8 | autophagy associated protein Atg8 | 2541386 | O94272 | II | Spom972h_chrII:3,684,281..3,685,459(-) | Spom972h_chrII:3684653..3685265(-) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 148 | OG6_100707 | 0 | 121 | 366 | 14155 | 8.41 | 0 | | | GO:0000421 | autophagosome membrane | | | | | GO:0005737;GO:0005829;GO:0000324;GO:0000329;GO:0005634 | cytoplasm;cytosol;fungal-type vacuole;fungal-type vacuole membrane;nucleus | GO:0005515 | protein binding | GO:0006914;GO:0006995;GO:0016236;GO:0061025;GO:0007033 | autophagy;cellular response to nitrogen starvation;macroautophagy;membrane fusion;vacuole organization | | | https://pubmed.ncbi.nlm.nih.gov/?term=SPBP8B7.24cORautophagy associated protein Atg8ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBP8B7.24c OR autophagy associated protein Atg8 AND Schizosaccharomyces pombe 972h- |
|
SPBPB2B2.05 | SPBPB2B2.05.1 | 1 | 1 | 1 | 97 | 237 | forward | protein coding | No | 1096 | SPBPB2B2.05 | peptidase family C26 protein | peptidase family C26 protein | 2541359 | Q9HDV0 | II | Spom972h_chrII:4,466,517..4,467,612(+) | Spom972h_chrII:4466754..4467515(+) | Spom972h_chrII | Schizosaccharomyces pombe 972h- | 4 | OG6_107498 | 0 | 253 | 762 | 27905 | 8.37 | 0 | | | | | GO:0016787 | hydrolase activity | | | GO:0005737;GO:0005829;GO:0005634 | cytoplasm;cytosol;nucleus | GO:0016811 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides | GO:0008150 | biological_process | | 2.4.2.- (Pentosyltransferases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPBPB2B2.05ORpeptidase family C26 proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPBPB2B2.05 OR peptidase family C26 protein AND Schizosaccharomyces pombe 972h- |
|
SPCC11E10.02c | SPCC11E10.02c.1 | 1 | 1 | 1 | 275 | 183 | reverse | protein coding | No | 1601 | SPCC11E10.02c | pig-K | pig-K | 2539272 | Q9USP5 | III | Spom972h_chrIII:1,454,541..1,456,141(-) | Spom972h_chrIII:1454816..1455958(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 153 | OG6_101767 | 0 | 380 | 1143 | 43205 | 5.81 | 0 | NN: MIVQFVALLLLNLLQIIAAE, HMM: MIVQFVALLLLNLLQIIAAE | NN Sum: 4, NN D: .89, HMM Prob: 1 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | GO:0042765;GO:0005783 | GPI-anchor transamidase complex;endoplasmic reticulum | GO:0003923;GO:0004197 | GPI-anchor transamidase activity;cysteine-type endopeptidase activity | GO:0016255;GO:0034394 | attachment of GPI anchor to protein;protein localization to cell surface | 3.-.-.- (Hydrolases.) | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC11E10.02cORpig-KANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC11E10.02c OR pig-K AND Schizosaccharomyces pombe 972h- |
|
SPCC1259.02c | SPCC1259.02c.1 | 3 | 3 | 1 | 347 | 694 | reverse | protein coding | No | 3510 | SPCC1259.02c | Endoplasmic Reticulum metallopeptidase Erm1 (predicted) | Endoplasmic Reticulum metallopeptidase Erm1 (predicted) | 2539040 | O94702 | III | Spom972h_chrIII:1,034,065..1,037,848(-) | Spom972h_chrIII:1034412..1036880(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 60 | OG6_101747 | 0 | 822 | 2469 | 91841 | 5.13 | 6 | NN: MVLVCASSSKCKRNTFLQLAMVLFAVVMAR, HMM: MVLVCASSSKCKRNTFLQLAMVLFAVVMAR | NN Sum: 4, NN D: .57, HMM Prob: .9 | | | GO:0046872 | metal ion binding | | | GO:0030176 | integral component of endoplasmic reticulum membrane | GO:0008233 | peptidase activity | GO:0008150 | biological_process | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1259.02cOREndoplasmic Reticulum metallopeptidase Erm1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1259.02c OR Endoplasmic Reticulum metallopeptidase Erm1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC1259.10 | SPCC1259.10.1 | 3 | 3 | 1 | 114 | 460 | forward | protein coding | No | 1813 | SPCC1259.10 | mitochondrial metallopeptidase, tRNA N6-threonyl-carbamoyl-adenosine (t6A), a modification protein Pgp1 | mitochondrial metallopeptidase, tRNA N6-threonyl-carbamoyl-adenosine (t6A), a modification protein Pgp1 | 2539074 | O94710 | III | Spom972h_chrIII:1,051,858..1,053,763(+) | Spom972h_chrIII:1052318..1053649(+) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 304 | OG6_100288 | 1 | 412 | 1239 | 45973 | 9.04 | 0 | | | | | GO:0061711;GO:0004222 | N(6)-L-threonylcarbamoyladenine synthase activity;metalloendopeptidase activity | | | GO:0000408;GO:0005739 | EKC/KEOPS complex;mitochondrion | GO:0004252;GO:0008270 | serine-type endopeptidase activity;zinc ion binding | GO:0072670 | mitochondrial tRNA threonylcarbamoyladenosine modification | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1259.10ORmitochondrial metallopeptidase, tRNA N6-threonyl-carbamoyl-adenosine (t6A), a modification protein Pgp1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1259.10 OR mitochondrial metallopeptidase, tRNA N6-threonyl-carbamoyl-adenosine (t6A), a modification protein Pgp1 AND Schizosaccharomyces pombe 972h- |
|
SPCC1322.05c | SPCC1322.05c.1 | 1 | 1 | 1 | 272 | 246 | reverse | protein coding | No | 2357 | SPCC1322.05c | vacuolar aminopeptidase | vacuolar aminopeptidase | 2538917 | O94544 | III | Spom972h_chrIII:1,293,804..1,296,160(-) | Spom972h_chrIII:1294076..1295914(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 190 | OG6_101703 | 0 | 612 | 1839 | 69521 | 6.25 | 0 | | | | | GO:0005488;GO:0008237;GO:0008270 | binding;metallopeptidase activity;zinc ion binding | | | GO:0061957;GO:0005829;GO:0000328;GO:0005771;GO:0005634 | NVT complex;cytosol;fungal-type vacuole lumen;multivesicular body;nucleus | GO:0004301;GO:0070006;GO:0008270 | epoxide hydrolase activity;metalloaminopeptidase activity;zinc ion binding | GO:0044255;GO:0043171;GO:0030163;GO:0120113 | cellular lipid metabolic process;peptide catabolic process;protein catabolic process;protein localization by the NVT pathway | 3.3.2.10 (Soluble epoxide hydrolase);3.4.11.- (Aminopeptidases.) | 3.3.2.10 (Soluble epoxide hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1322.05cORvacuolar aminopeptidaseANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1322.05c OR vacuolar aminopeptidase AND Schizosaccharomyces pombe 972h- |
|
SPCC1442.06 | SPCC1442.06.1 | 4 | 4 | 1 | 1247 | 87 | forward | protein coding | No | 2072 | SPCC1442.06 | 20S proteasome complex subunit alpha 2, Pre8 (predicted) | 20S proteasome complex subunit alpha 2, Pre8 (predicted) | 2539026 | O94579 | III | Spom972h_chrIII:1,778,069..1,780,442(+) | Spom972h_chrIII:1778156..1779195(+) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 148 | OG6_101969 | 0 | 245 | 738 | 26403 | 4.74 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829;GO:0005634;GO:0005839;GO:0019773 | cytoplasm;cytosol;nucleus;proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1442.06OR20S proteasome complex subunit alpha 2, Pre8 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1442.06 OR 20S proteasome complex subunit alpha 2, Pre8 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC1442.07c | SPCC1442.07c.1 | 1 | 1 | 1 | 90 | 245 | reverse | protein coding | No | 1184 | SPCC1442.07c | ubiquitin/metalloprotease fusion protein Udp7 | ubiquitin/metalloprotease fusion protein Udp7 | 2538751 | O94580 | III | Spom972h_chrIII:1,779,522..1,780,705(-) | Spom972h_chrIII:1779612..1780460(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 136 | OG6_109514 | 0 | 282 | 849 | 32464 | 7.21 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005829;GO:0005634 | cytosol;nucleus | GO:0008237;GO:0070628;GO:0008270 | metallopeptidase activity;proteasome binding;zinc ion binding | GO:0006974;GO:0016925 | cellular response to DNA damage stimulus;protein sumoylation | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1442.07cORubiquitin/metalloprotease fusion protein Udp7ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1442.07c OR ubiquitin/metalloprotease fusion protein Udp7 AND Schizosaccharomyces pombe 972h- |
|
SPCC1494.05c | SPCC1494.05c.1 | 1 | 1 | 1 | 599 | 106 | reverse | protein coding | No | 3645 | SPCC1494.05c | CSN-associated deubiquitinating enzyme Ubp12 | CSN-associated deubiquitinating enzyme Ubp12 | 2538990 | O60079 | III | Spom972h_chrIII:2,328,869..2,332,513(-) | Spom972h_chrIII:2329468..2332407(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 197 | OG6_100913 | 1 | 979 | 2940 | 111966 | 4.46 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829;GO:0005634 | cytoplasm;cytosol;nucleus | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1494.05cORCSN-associated deubiquitinating enzyme Ubp12ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1494.05c OR CSN-associated deubiquitinating enzyme Ubp12 AND Schizosaccharomyces pombe 972h- |
|
SPCC1682.10 | SPCC1682.10.1 | 2 | 2 | 1 | 327 | 73 | forward | protein coding | No | 1375 | SPCC1682.10 | 19S proteasome regulatory subunit Rpn8 (predicted) | 19S proteasome regulatory subunit Rpn8 (predicted) | 2538912 | O74440 | III | Spom972h_chrIII:390,674..392,092(+) | Spom972h_chrIII:390747..391765(+) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 158 | OG6_102054 | 0 | 324 | 975 | 35595 | 4.71 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005829;GO:1990023;GO:0005635;GO:0005634;GO:0000502;GO:0008541 | cytosol;mitotic spindle midzone;nuclear envelope;nucleus;proteasome complex;proteasome regulatory particle, lid subcomplex | GO:0003674 | molecular_function | GO:0045842;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasome-mediated ubiquitin-dependent protein catabolic process | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1682.10OR19S proteasome regulatory subunit Rpn8 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1682.10 OR 19S proteasome regulatory subunit Rpn8 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC1682.12c | SPCC1682.12c.1 | 1 | 1 | 1 | 69 | 885 | reverse | protein coding | No | 2328 | SPCC1682.12c | ubiquitin C-terminal hydrolase Ubp16 | ubiquitin C-terminal hydrolase Ubp16 | 2538947 | O74442 | III | Spom972h_chrIII:394,814..397,141(-) | Spom972h_chrIII:394883..396256(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 72 | OG6_101457 | 0 | 457 | 1374 | 51581 | 10.04 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005730;GO:0005634 | nucleolus;nucleus | GO:0004197;GO:0004843;GO:0101005 | cysteine-type endopeptidase activity;thiol-dependent ubiquitin-specific protease activity;ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1682.12cORubiquitin C-terminal hydrolase Ubp16ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1682.12c OR ubiquitin C-terminal hydrolase Ubp16 AND Schizosaccharomyces pombe 972h- |
|
SPCC1682.16 | SPCC1682.16.1 | 2 | 2 | 1 | 344 | 74 | forward | protein coding | No | 1585 | SPCC1682.16 | 19S proteasome regulatory subunit Rpt4 (predicted) | 19S proteasome regulatory subunit Rpt4 (predicted) | 2539189 | O74445 | III | Spom972h_chrIII:405,538..407,595(+) | Spom972h_chrIII:405612..407251(+) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 166 | OG6_101751 | 0 | 388 | 1167 | 43607 | 5.89 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005829;GO:0031597;GO:0005634;GO:0008540 | cytosol;cytosolic proteasome complex;nucleus;proteasome regulatory particle, base subcomplex | GO:0005524;GO:0036402 | ATP binding;proteasome-activating ATPase activity | GO:0031939;GO:0045899;GO:0045842;GO:0043161;GO:1902801;GO:0030433 | negative regulation of chromatin silencing at telomere;positive regulation of RNA polymerase II transcriptional preinitiation complex assembly;positive regulation of mitotic metaphase/anaphase transition;proteasome-mediated ubiquitin-dependent protein catabolic process;regulation of heterochromatin | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1682.16OR19S proteasome regulatory subunit Rpt4 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1682.16 OR 19S proteasome regulatory subunit Rpt4 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC16A11.12c | SPCC16A11.12c.1 | 2 | 2 | 1 | 156 | 179 | reverse | protein coding | No | 2885 | SPCC16A11.12c | ubiquitin C-terminal hydrolase Ubp1 | ubiquitin C-terminal hydrolase Ubp1 | 2539228 | Q9USM5 | III | Spom972h_chrIII:889,281..892,390(-) | Spom972h_chrIII:889437..892211(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 197 | OG6_100913 | 1 | 849 | 2550 | 98654 | 5.61 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005783 | endoplasmic reticulum | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC16A11.12cORubiquitin C-terminal hydrolase Ubp1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC16A11.12c OR ubiquitin C-terminal hydrolase Ubp1 AND Schizosaccharomyces pombe 972h- |
|
SPCC1795.04c | SPCC1795.04c.1 | 4 | 4 | 1 | 431 | 86 | forward | protein coding | No | 1279 | SPCC1795.04c | 20S proteasome complex subunit alpha 7, Pre10 (predicted) | 20S proteasome complex subunit alpha 7, Pre10 (predicted) | 2539378 | O59770 | III | Spom972h_chrIII:990,627..992,059(+) | Spom972h_chrIII:990713..991628(+) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 156 | OG6_102011 | 0 | 253 | 762 | 28031 | 4.83 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005829;GO:0005634;GO:0005839;GO:0019773 | cytoplasm;cytosol;nucleus;proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1795.04cOR20S proteasome complex subunit alpha 7, Pre10 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1795.04c OR 20S proteasome complex subunit alpha 7, Pre10 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC1795.09 | SPCC1795.09.1 | 1 | 1 | 1 | 386 | 807 | reverse | protein coding | No | 2759 | SPCC1795.09 | aspartic protease, yapsin Yps1 | aspartic protease, yapsin Yps1 | 2538927 | O59774 | III | Spom972h_chrIII:978,227..980,985(-) | Spom972h_chrIII:978613..980178(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 406 | OG6_114704 | 1 | 521 | 1566 | 57622 | 4.42 | 0 | NN: MRIWILIFFSFIKLVSSL, HMM: MRIWILIFFSFIKLVSSL | NN Sum: 4, NN D: .91, HMM Prob: .99 | GO:0016021 | integral component of membrane | | | | | GO:0031362;GO:0005618;GO:0005576;GO:0009277 | anchored component of external side of plasma membrane;cell wall;extracellular region;fungal-type cell wall | GO:0004190 | aspartic-type endopeptidase activity | GO:0008150;GO:0031505;GO:0030163;GO:0006508 | biological_process;fungal-type cell wall organization;protein catabolic process;proteolysis | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1795.09ORaspartic protease, yapsin Yps1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1795.09 OR aspartic protease, yapsin Yps1 AND Schizosaccharomyces pombe 972h- |
|
SPCC1840.04 | SPCC1840.04.1 | 6 | 6 | 1 | 1849 | 63 | forward | protein coding | No | 3190 | SPCC1840.04 | metacaspase Pca1 | metacaspase Pca1 | 2538976 | O74477 | III | Spom972h_chrIII:2,263,904..2,267,305(+) | Spom972h_chrIII:2263967..2265456(+) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 299 | OG6_101407 | 0 | 425 | 1278 | 46626 | 5.98 | 0 | | | | | | | | | GO:0005737;GO:0005829;GO:0005634 | cytoplasm;cytosol;nucleus | GO:0004197 | cysteine-type endopeptidase activity | GO:0006915;GO:0051603 | apoptotic process;proteolysis involved in cellular protein catabolic process | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1840.04ORmetacaspase Pca1ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1840.04 OR metacaspase Pca1 AND Schizosaccharomyces pombe 972h- |
|
SPCC188.08c | SPCC188.08c.1 | 3 | 3 | 1 | 381 | 85 | reverse | protein coding | No | 3793 | SPCC188.08c | ubiquitin C-terminal hydrolase Ubp5 | ubiquitin C-terminal hydrolase Ubp5 | 2539385 | Q09879 | III | Spom972h_chrIII:1,488,553..1,492,475(-) | Spom972h_chrIII:1488934..1492390(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 221 | OG6_101317 | 1 | 1108 | 3327 | 128666 | 5.17 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005794;GO:0005829;GO:0005634 | Golgi apparatus;cytosol;nucleus | GO:0004197;GO:0004175;GO:0004843;GO:0036459;GO:0008134 | cysteine-type endopeptidase activity;endopeptidase activity;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;transcription factor binding | GO:0035871;GO:0070536;GO:0016579;GO:0051090;GO:0031647 | protein K11-linked deubiquitination;protein K63-linked deubiquitination;protein deubiquitination;regulation of DNA-binding transcription factor activity;regulation of protein stability | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC188.08cORubiquitin C-terminal hydrolase Ubp5ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC188.08c OR ubiquitin C-terminal hydrolase Ubp5 AND Schizosaccharomyces pombe 972h- |
|
SPCC1919.12c | SPCC1919.12c.1 | 1 | 1 | 1 | 1995 | 142 | reverse | protein coding | No | 4669 | SPCC1919.12c | metallopeptidase (predicted) | metallopeptidase (predicted) | 2539157 | O94479 | III | Spom972h_chrIII:2,231,453..2,236,121(-) | Spom972h_chrIII:2233448..2235979(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 117 | OG6_116543 | 0 | 843 | 2532 | 95646 | 7.61 | 9 | | | | | GO:0046872 | metal ion binding | | | GO:0005829;GO:0000329;GO:0016021 | cytosol;fungal-type vacuole membrane;integral component of membrane | GO:0008237 | metallopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC1919.12cORmetallopeptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC1919.12c OR metallopeptidase (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC320.12 | SPCC320.12.1 | 2 | 2 | 1 | 281 | 329 | reverse | protein coding | No | 1168 | SPCC320.12 | mitochondrial inner membrane peptidase Atp23 (predicted) | mitochondrial inner membrane peptidase Atp23 (predicted) | 2538697 | Q1MTR0 | III | Spom972h_chrIII:142,939..144,172(-) | Spom972h_chrIII:143220..143843(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 141 | OG6_102968 | 0 | 185 | 558 | 21511 | 8.27 | 0 | | | | | GO:0046872;GO:0004222 | metal ion binding;metalloendopeptidase activity | | | GO:0031314;GO:0005743 | extrinsic component of mitochondrial inner membrane;mitochondrial inner membrane | GO:0004222 | metalloendopeptidase activity | GO:0034982;GO:0033615 | mitochondrial protein processing;mitochondrial proton-transporting ATP synthase complex assembly | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC320.12ORmitochondrial inner membrane peptidase Atp23 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC320.12 OR mitochondrial inner membrane peptidase Atp23 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC4G3.10c | SPCC4G3.10c.1 | 1 | 1 | 1 | 384 | 564 | forward | protein coding | No | 3009 | SPCC4G3.10c | DNA repair protein Rhp42 | DNA repair protein Rhp42 | 2539465 | P87235 | III | Spom972h_chrIII:451,805..454,813(+) | Spom972h_chrIII:452369..454429(+) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 236 | OG6_102113 | 1 | 686 | 2061 | 79023 | 8.99 | 0 | | | | | GO:0003677 | DNA binding | | | GO:0071942;GO:0005737;GO:0005730;GO:0000109;GO:0000111 | XPC complex;cytoplasm;nucleolus;nucleotide-excision repair complex;nucleotide-excision repair factor 2 complex | GO:0003684;GO:0003697 | damaged DNA binding;single-stranded DNA binding | GO:0006298;GO:0006289 | mismatch repair;nucleotide-excision repair | | 2.1.1.201 (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC4G3.10cORDNA repair protein Rhp42ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC4G3.10c OR DNA repair protein Rhp42 AND Schizosaccharomyces pombe 972h- |
|
SPCC576.10c | SPCC576.10c.1 | 1 | 1 | 1 | 390 | 45 | reverse | protein coding | No | 1605 | SPCC576.10c | 19S proteasome regulatory subunit Rpt3 (predicted) | 19S proteasome regulatory subunit Rpt3 (predicted) | 2539539 | O74894 | III | Spom972h_chrIII:2,097,289..2,098,893(-) | Spom972h_chrIII:2097679..2098848(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 151 | OG6_101965 | 0 | 389 | 1170 | 43552 | 5.02 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005829;GO:0031597;GO:0000790;GO:0034399;GO:0008540 | cytoplasm;cytosol;cytosolic proteasome complex;nuclear chromatin;nuclear periphery;proteasome regulatory particle, base subcomplex | GO:0036402 | proteasome-activating ATPase activity | GO:0061641;GO:0045899;GO:0045842;GO:0043161 | CENP-A containing chromatin organization;positive regulation of RNA polymerase II transcriptional preinitiation complex assembly;positive regulation of mitotic metaphase/anaphase transition;proteasome-mediated ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC576.10cOR19S proteasome regulatory subunit Rpt3 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC576.10c OR 19S proteasome regulatory subunit Rpt3 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC5E4.05c | SPCC5E4.05c.1 | 1 | 1 | 1 | 182 | 166 | reverse | protein coding | No | 1485 | SPCC5E4.05c | mitochondrial acylglycerol lipase Mgl1 (predicted) | mitochondrial acylglycerol lipase Mgl1 (predicted) | 2538799 | O94305 | III | Spom972h_chrIII:649,474..650,958(-) | Spom972h_chrIII:649656..650792(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 293 | OG6_100231 | 0 | 378 | 1137 | 41623 | 5.85 | 0 | | | GO:0005811 | lipid droplet | | | | | GO:0005737;GO:0016020;GO:0005741 | cytoplasm;membrane;mitochondrial outer membrane | GO:0047372 | acylglycerol lipase activity | GO:0019433 | triglyceride catabolic process | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC5E4.05cORmitochondrial acylglycerol lipase Mgl1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC5E4.05c OR mitochondrial acylglycerol lipase Mgl1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC613.10 | SPCC613.10.1 | 1 | 1 | 1 | 209 | 96 | forward | protein coding | No | 1586 | SPCC613.10 | ubiquinol-cytochrome-c reductase complex core protein Qcr2 (predicted) | ubiquinol-cytochrome-c reductase complex core protein Qcr2 (predicted) | 2538983 | P78761 | III | Spom972h_chrIII:96,625..98,210(+) | Spom972h_chrIII:96721..98001(+) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 132 | OG6_103720 | 0 | 426 | 1281 | 45650 | 9.49 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005743;GO:0017087;GO:0005750;GO:0005739 | mitochondrial inner membrane;mitochondrial processing peptidase complex;mitochondrial respiratory chain complex III;mitochondrion | GO:0004175;GO:0005198;GO:0008121 | endopeptidase activity;structural molecule activity;ubiquinol-cytochrome-c reductase activity | GO:0006122;GO:0006627 | mitochondrial electron transport, ubiquinol to cytochrome c;protein processing involved in protein targeting to mitochondrion | | 1.10.2.2 (Transferred entry: 7.1.1.8) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC613.10ORubiquinol-cytochrome-c reductase complex core protein Qcr2 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC613.10 OR ubiquinol-cytochrome-c reductase complex core protein Qcr2 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC63.12c | SPCC63.12c.1 | 1 | 1 | 1 | 558 | 83 | reverse | protein coding | No | 1256 | SPCC63.12c | 20S proteasome complex subunit beta 3, Pup3 (predicted) | 20S proteasome complex subunit beta 3, Pup3 (predicted) | 2539401 | Q9Y7T8 | III | Spom972h_chrIII:859,221..860,476(-) | Spom972h_chrIII:859779..860393(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 163 | OG6_101970 | 0 | 204 | 615 | 22660 | 4.49 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0043161;GO:0051603 | proteasome-mediated ubiquitin-dependent protein catabolic process;proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005829;GO:0005634;GO:0005839;GO:0019774 | cytoplasm;cytosol;nucleus;proteasome core complex;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0045842;GO:0010498;GO:0010499;GO:0043161 | positive regulation of mitotic metaphase/anaphase transition;proteasomal protein catabolic process;proteasomal ubiquitin-independent protein catabolic process;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC63.12cOR20S proteasome complex subunit beta 3, Pup3 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC63.12c OR 20S proteasome complex subunit beta 3, Pup3 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC757.03c | SPCC757.03c.1 | 1 | 1 | 1 | 416 | 102 | reverse | protein coding | No | 1253 | SPCC757.03c | glyoxylase III Hsp3101 | glyoxylase III Hsp3101 | 2539466 | O74914 | III | Spom972h_chrIII:47,325..48,577(-) | Spom972h_chrIII:47741..48475(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 278 | OG6_105123 | 3 | 244 | 735 | 26743 | 5.35 | 0 | | | | | | | | | GO:0005737;GO:0005829;GO:0005634 | cytoplasm;cytosol;nucleus | GO:0019172 | glyoxalase III activity | GO:1990748 | cellular detoxification | 4.2.1.130 (D-lactate dehydratase) | 4.2.1.130 (D-lactate dehydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC757.03cORglyoxylase III Hsp3101ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC757.03c OR glyoxylase III Hsp3101 AND Schizosaccharomyces pombe 972h- |
|
SPCC757.05c | SPCC757.05c.1 | 1 | 1 | 1 | 312 | 256 | reverse | protein coding | No | 1771 | SPCC757.05c | peptidase family M20 protein | peptidase family M20 protein | 2539223 | O74916 | III | Spom972h_chrIII:52,598..54,368(-) | Spom972h_chrIII:52910..54112(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 137 | OG6_108287 | 0 | 400 | 1203 | 44283 | 4.87 | 1 | HMM: MTMKISVWSLLIVIGYHLWMSPVLAG, NN: MTMKISVWSLLIVIGYHLWMSPVLAG | NN Sum: 4, NN D: .87, HMM Prob: 1 | | | GO:0016787;GO:0046872 | hydrolase activity;metal ion binding | GO:0008152 | metabolic process | GO:0005575 | cellular_component | GO:0008237 | metallopeptidase activity | GO:1990748;GO:0006751 | cellular detoxification;glutathione catabolic process | | 3.4.17.- (Metallocarboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC757.05cORpeptidase family M20 proteinANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC757.05c OR peptidase family M20 protein AND Schizosaccharomyces pombe 972h- |
|
SPCC790.03 | SPCC790.03.1 | 3 | 3 | 1 | 328 | 378 | forward | protein coding | No | 1462 | SPCC790.03 | rhomboid family protease | rhomboid family protease | 2539469 | O74926 | III | Spom972h_chrIII:2,245,582..2,247,243(+) | Spom972h_chrIII:2245960..2246915(+) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 15 | OG6_116870 | 0 | 251 | 756 | 28210 | 9.62 | 6 | HMM: MIFMILGRSKEFILKLPIWTQIITYIAILVYALSFFGISTGVLSL, NN: MIFMILGRSKEFILKLPIWTQIITYIAILVYAL | NN Sum: 2, NN D: .52, HMM Prob: 0 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0005794;GO:0000139 | Golgi apparatus;Golgi membrane | GO:0005515;GO:0004252 | protein binding;serine-type endopeptidase activity | GO:0035103 | sterol regulatory element binding protein cleavage | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC790.03ORrhomboid family proteaseANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC790.03 OR rhomboid family protease AND Schizosaccharomyces pombe 972h- |
|
SPCC965.04c | SPCC965.04c.1 | 2 | 2 | 1 | 203 | 164 | reverse | protein coding | No | 2497 | SPCC965.04c | mitochondrial inner membrane i-AAA protease complex subunit Yme1 (predicted) | mitochondrial inner membrane i-AAA protease complex subunit Yme1 (predicted) | 2538746 | O59824 | III | Spom972h_chrIII:2,286,794..2,289,391(-) | Spom972h_chrIII:2286997..2289227(-) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 152 | OG6_101196 | 0 | 709 | 2130 | 78217 | 8.79 | 1 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0005524;GO:0046872;GO:0004222 | ATP binding;metal ion binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0031942;GO:0005743;GO:0005739 | i-AAA complex;mitochondrial inner membrane;mitochondrion | GO:0004176 | ATP-dependent peptidase activity | GO:0035694;GO:0007005;GO:0006515;GO:0006508 | mitochondrial protein catabolic process;mitochondrion organization;protein quality control for misfolded or incompletely synthesized proteins;proteolysis | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC965.04cORmitochondrial inner membrane i-AAA protease complex subunit Yme1 (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC965.04c OR mitochondrial inner membrane i-AAA protease complex subunit Yme1 (predicted) AND Schizosaccharomyces pombe 972h- |
|
SPCC965.12 | SPCC965.12.1 | 2 | 2 | 1 | 315 | 334 | forward | protein coding | No | 1900 | SPCC965.12 | dipeptidyl peptidase (predicted) | dipeptidyl peptidase (predicted) | 2539107 | O59832 | III | Spom972h_chrIII:2,305,902..2,307,857(+) | Spom972h_chrIII:2306292..2307542(+) | Spom972h_chrIII | Schizosaccharomyces pombe 972h- | 195 | OG6_102004 | 1 | 416 | 1251 | 47420 | 5.92 | 0 | | | | | GO:0016805;GO:0046872 | dipeptidase activity;metal ion binding | GO:0006508 | proteolysis | GO:0005829;GO:0005634 | cytosol;nucleus | GO:0070573 | metallodipeptidase activity | GO:0008150 | biological_process | 3.4.13.19 (Membrane dipeptidase) | 3.4.13.19 (Membrane dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=SPCC965.12ORdipeptidyl peptidase (predicted)ANDSchizosaccharomyces pombe 972h- | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=SPCC965.12 OR dipeptidyl peptidase (predicted) AND Schizosaccharomyces pombe 972h- |
